BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0750 (775 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 23 2.1 AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 23 3.6 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 22 6.3 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 22 6.3 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 23.4 bits (48), Expect = 2.1 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 80 RDTESFIDLIIKTGGGVGFRMRSP 151 +D E + L +GGG G +MR P Sbjct: 101 KDDEKCLSLERPSGGGKGKKMRKP 124 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 22.6 bits (46), Expect = 3.6 Identities = 15/58 (25%), Positives = 28/58 (48%) Frame = -1 Query: 238 YQGRIFPCNHFFTHISVFYRTVMTNHN*VRASHSKTNTSASFYYEINERLCITALSFW 65 Y RIF N F HI RT++ + V+ + N ++S +++ + I+ + W Sbjct: 150 YFNRIFGWNILFGHIFTVCRTLIYIDDNVKGLGKQYNIASSKTLKLSINI-ISLVQLW 206 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -2 Query: 132 PTPPPVFIMRSMNDSVSRRCLSGVITTQ 49 P+PPP + D+ S+R + +TQ Sbjct: 101 PSPPPEERLTPSKDASSKRIXTAFTSTQ 128 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 328 RLPASARLGLQCISFLW 278 RLPA +GL+C+ L+ Sbjct: 367 RLPALRSIGLKCLEHLF 383 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,129 Number of Sequences: 336 Number of extensions: 4473 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20857569 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -