BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0746 (786 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g71210.1 68414.m08217 pentatricopeptide (PPR) repeat-containi... 29 3.5 At5g56340.1 68418.m07032 zinc finger (C3HC4-type RING finger) fa... 29 4.6 At2g45540.1 68415.m05663 WD-40 repeat family protein / beige-rel... 28 6.1 At1g29880.1 68414.m03652 glycyl-tRNA synthetase / glycine--tRNA ... 28 6.1 >At1g71210.1 68414.m08217 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 879 Score = 29.1 bits (62), Expect = 3.5 Identities = 17/62 (27%), Positives = 28/62 (45%) Frame = +2 Query: 56 ITIFAAGVLADDFSQITAVVTSQCTKNNAEDKVPEVEAALRTFGNCLKGLVDLNVLKTEI 235 IT F VL + + V + N EDK+PE+++ G G +D+ V + Sbjct: 740 ITAFIGNVLLHNAMKSKGVYEAWTRMRNIEDKIPEMKSLGELIG-LFSGRIDMEVELKRL 798 Query: 236 EE 241 +E Sbjct: 799 DE 800 >At5g56340.1 68418.m07032 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 396 Score = 28.7 bits (61), Expect = 4.6 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +1 Query: 259 LDEVFKKYCDKSAQLKGCISSVLQGVRPCVGNEYANHINDAQNS 390 LD F+ + + G I +LQG+R + +EY + N+ NS Sbjct: 136 LDREFESILRRRRRSSGNILQLLQGIRAGIASEYESSDNNWDNS 179 >At2g45540.1 68415.m05663 WD-40 repeat family protein / beige-related contains Pfam PF02138: Beige/BEACH domain; contains Pfam PF00400: WD domain, G-beta repeat (3 copies) Length = 2946 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +2 Query: 80 LADDFSQITAVVTSQCTKNNAEDKVPEVEAALRTFGNCLKGLVD 211 +AD QI+AV + T +A + V A ++G+C L + Sbjct: 1443 MADSSGQISAVAMERLTAASAAEPYESVSCAFVSYGSCAMDLAE 1486 >At1g29880.1 68414.m03652 glycyl-tRNA synthetase / glycine--tRNA ligase identical to SP|O23627 Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine--tRNA ligase) (GlyRS) {Arabidopsis thaliana} Length = 729 Score = 28.3 bits (60), Expect = 6.1 Identities = 19/67 (28%), Positives = 30/67 (44%) Frame = +2 Query: 98 QITAVVTSQCTKNNAEDKVPEVEAALRTFGNCLKGLVDLNVLKTEIEEAKPNVHSTRFSR 277 QI T Q + + +K VEA GN ++ L K EI+ A ++ + + Sbjct: 37 QIPMDATEQSLRQSLSEKSSSVEAQ----GNAVRALKASRAAKPEIDAAIEQLNKLKLEK 92 Query: 278 STVTRVL 298 STV + L Sbjct: 93 STVEKEL 99 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,493,446 Number of Sequences: 28952 Number of extensions: 337119 Number of successful extensions: 918 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 895 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 918 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1765546400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -