BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0740 (756 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 25 0.65 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 22 4.6 DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped prot... 22 6.1 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 25.0 bits (52), Expect = 0.65 Identities = 10/40 (25%), Positives = 18/40 (45%) Frame = +2 Query: 38 GDHSSYA*FNEKTPNMTLCDFVPGCYY*YYKSIQRFSEHF 157 G H + + + P +T C PG + Y+ ++ HF Sbjct: 137 GHHQKNSPYMDGVPFVTQCPIHPGMTFRYHFNVHNSGTHF 176 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 22.2 bits (45), Expect = 4.6 Identities = 7/26 (26%), Positives = 15/26 (57%) Frame = -3 Query: 574 QSWIRPWVKEYLVEATFHSTRDFIFT 497 ++W P+V ++ FH+ F++T Sbjct: 108 KAWFLPFVVTNIIFVLFHTYEAFVWT 133 >DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped protein. Length = 126 Score = 21.8 bits (44), Expect = 6.1 Identities = 8/27 (29%), Positives = 12/27 (44%) Frame = -3 Query: 586 PSWRQSWIRPWVKEYLVEATFHSTRDF 506 PS+ W P+ +YL A + F Sbjct: 31 PSYCDPWYNPYYYQYLQNAALYHKLQF 57 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,653 Number of Sequences: 336 Number of extensions: 2870 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20234955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -