BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0735 (644 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY187042-1|AAO39756.1| 248|Anopheles gambiae putative antennal ... 23 6.3 U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 23 8.3 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 8.3 AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. 23 8.3 AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. 23 8.3 AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 23 8.3 >AY187042-1|AAO39756.1| 248|Anopheles gambiae putative antennal carrier protein TOL-2 protein. Length = 248 Score = 23.4 bits (48), Expect = 6.3 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = -3 Query: 237 NKESILNLNTALKTAMGGIILEKINHIVKTDERVIYSDHLSSLFN 103 N + ++ N AL+ G ++N I T + + HL++LFN Sbjct: 147 NCDFLMKWNGALEKRANGKEYYQMNKIKATFDTTRFYMHLTNLFN 191 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 23.0 bits (47), Expect = 8.3 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +1 Query: 97 ASIEKGAQVVAINDPFIGLDYMVYLFKYDS 186 A +EKG N+ ++ Y V+ F Y+S Sbjct: 89 AFLEKGELFSIYNEQYLRQTYAVFTFLYNS 118 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.0 bits (47), Expect = 8.3 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = +1 Query: 169 LFKYDSTHGRFKGSVEVQDGFLVVNG*QNAVFSERDPKAIPRGK 300 L K D+T G + + ++ NG V + + P+A P+ K Sbjct: 1201 LMKKDATLGGNATTSTSNEAHVIANGHDGPVSAGKPPQAPPKAK 1244 >AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.0 bits (47), Expect = 8.3 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +1 Query: 97 ASIEKGAQVVAINDPFIGLDYMVYLFKYDS 186 A +EKG N+ ++ Y V+ F Y+S Sbjct: 89 AFLEKGELFSIYNEQYLRQTYAVFTFLYNS 118 >AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.0 bits (47), Expect = 8.3 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +1 Query: 97 ASIEKGAQVVAINDPFIGLDYMVYLFKYDS 186 A +EKG N+ ++ Y V+ F Y+S Sbjct: 89 AFLEKGELFSIYNEQYLRQTYAVFTFLYNS 118 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.0 bits (47), Expect = 8.3 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +1 Query: 97 ASIEKGAQVVAINDPFIGLDYMVYLFKYDS 186 A +EKG N+ ++ Y V+ F Y+S Sbjct: 89 AFLEKGELFSIYNEQYLRQTYAVFTFLYNS 118 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 714,604 Number of Sequences: 2352 Number of extensions: 14520 Number of successful extensions: 23 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63559560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -