BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0731 (565 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 25 0.45 AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esteras... 25 0.59 AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. 24 0.78 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 24 0.78 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 21 5.5 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 25.0 bits (52), Expect = 0.45 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = +1 Query: 382 ILAGDYDHLPEVAFYMV--GPIEEVVAKADT 468 I +GDY+H+P + Y G I E++ K +T Sbjct: 291 IKSGDYNHVPMIFGYTTREGMIVEMMRKTET 321 >AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esterase protein. Length = 517 Score = 24.6 bits (51), Expect = 0.59 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = +1 Query: 361 TIKGFSKILAGDYDHLPEVAFYMV--GPIEEVVAKADT 468 T + + I +GDY+H+P + Y G I E++ K +T Sbjct: 286 TDEPIATIKSGDYNHVPMIFGYTTREGMIVEMMRKNET 323 >AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. Length = 515 Score = 24.2 bits (50), Expect = 0.78 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = +1 Query: 382 ILAGDYDHLPEVAFYMV--GPIEEVVAKADT 468 I +GDY+H+P + Y G I E++ K +T Sbjct: 291 IKSGDYNHVPMIFGYTTREGMIVEMMRKNET 321 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 24.2 bits (50), Expect = 0.78 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = +1 Query: 382 ILAGDYDHLPEVAFYMV--GPIEEVVAKADT 468 I +GDY+H+P + Y G I E++ K +T Sbjct: 293 IKSGDYNHVPMIFGYTTREGMIVEMMRKNET 323 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 21.4 bits (43), Expect = 5.5 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -1 Query: 247 FRQLVHTQNSNNVLQGFVVLKNFLNSTCNIVVLSSNNIGVHDTGS 113 +R L T + N L G+ +L S N+V + +GV D G+ Sbjct: 619 YRILGETIETWNKLFGYQILLITFQSGLNVVSCINFPLGVLDRGN 663 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,251 Number of Sequences: 336 Number of extensions: 3071 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13890653 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -