BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0727 (788 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. 25 0.80 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 9.9 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 9.9 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 9.9 >DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. Length = 132 Score = 25.0 bits (52), Expect = 0.80 Identities = 13/50 (26%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = -3 Query: 225 VQCIFGRIVAANCETLFNQVRSHEPSHVSEAEESHILV-GVRTIRPSGGC 79 V C+ ++ N +T FN+ + E + ++E+ + LV + I S C Sbjct: 63 VDCMLKKVGFVNADTTFNEEKFRERTTKLDSEQVNRLVNNCKDITESNSC 112 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.4 bits (43), Expect = 9.9 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +1 Query: 700 RTEVLLDVLNNSSARSWSTEVTVQF 774 R +V +++LN+ SA S + +QF Sbjct: 507 RRKVTIEILNSLSATKLSKIILMQF 531 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.4 bits (43), Expect = 9.9 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +1 Query: 700 RTEVLLDVLNNSSARSWSTEVTVQF 774 R +V +++LN+ SA S + +QF Sbjct: 545 RRKVTIEILNSLSATKLSKIILMQF 569 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 9.9 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -3 Query: 705 GSSPILMPMFMHSAVAIPVMPIN 637 G + I MP FM +P P N Sbjct: 1140 GPNGIKMPSFMEGMPHLPFTPFN 1162 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 243,388 Number of Sequences: 438 Number of extensions: 5792 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24882285 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -