BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0726 (436 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC869.05c |||sulfate transporter |Schizosaccharomyces pombe|ch... 27 1.6 SPAC19A8.05c |vps27|sst4|sorting receptor for ubiquitinated memb... 25 5.0 SPBC6B1.07 |prp1|zer1|U4/U6 x U5 tri-snRNP complex subunit Prp1|... 25 6.7 SPAC5H10.04 |||NADPH dehydrogenase |Schizosaccharomyces pombe|ch... 24 8.8 SPBC29A10.04 |psm1|smc1|mitotic cohesin complex subunit Psm1 |Sc... 24 8.8 SPBC1604.01 |mug158|SPBC1677.01c|sulfatase modifying factor 1 re... 24 8.8 SPCC553.12c ||SPCC794.13|conserved fungal protein|Schizosaccharo... 24 8.8 >SPAC869.05c |||sulfate transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 840 Score = 26.6 bits (56), Expect = 1.6 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -1 Query: 130 FRSIPDDAFLTELARIQQ*RSSNFYKTLVYNFINILWNLY 11 + IP+D L ELA I Q N + NF++ L +L+ Sbjct: 68 YYEIPEDDELDELASIPQWFKKNVTSNIFKNFLHYLKSLF 107 >SPAC19A8.05c |vps27|sst4|sorting receptor for ubiquitinated membrane proteins, ESCRT 0 complex|Schizosaccharomyces pombe|chr 1|||Manual Length = 610 Score = 25.0 bits (52), Expect = 5.0 Identities = 9/24 (37%), Positives = 17/24 (70%) Frame = -2 Query: 231 VSMILHVHENSRSTVS*YPDPSEN 160 +S I+HV++N + +P+PS+N Sbjct: 133 LSYIIHVYQNLKDGDYEFPEPSQN 156 >SPBC6B1.07 |prp1|zer1|U4/U6 x U5 tri-snRNP complex subunit Prp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 906 Score = 24.6 bits (51), Expect = 6.7 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -1 Query: 145 LTADRFRSIPDDAFLTELARIQQ*RSSNFYKT 50 LT + + +IP+ LT R +Q R FY T Sbjct: 140 LTDEDWNNIPEPGDLTRKKRTKQPRRERFYAT 171 >SPAC5H10.04 |||NADPH dehydrogenase |Schizosaccharomyces pombe|chr 1|||Manual Length = 382 Score = 24.2 bits (50), Expect = 8.8 Identities = 10/29 (34%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = +3 Query: 198 CYFHEHAESWIP--DPISKSRMKILIHLF 278 C+ E AESWIP + + K++ + I + Sbjct: 77 CFTKEQAESWIPLVEAVHKNKSFLFIQFW 105 >SPBC29A10.04 |psm1|smc1|mitotic cohesin complex subunit Psm1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1233 Score = 24.2 bits (50), Expect = 8.8 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 147 LDICDSLMDQDIMTPLTCYFHEHAES 224 LD D+ +DQ +T + Y +HA S Sbjct: 1159 LDEIDAALDQTNVTKIANYIRQHASS 1184 >SPBC1604.01 |mug158|SPBC1677.01c|sulfatase modifying factor 1 related|Schizosaccharomyces pombe|chr 2|||Manual Length = 773 Score = 24.2 bits (50), Expect = 8.8 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = +3 Query: 168 MDQDIMTPLTCYFH-EHAESWIPDP 239 +D DI P C++H E ESW P P Sbjct: 414 IDPDIEDPSKCHWHSEVPESW-PSP 437 >SPCC553.12c ||SPCC794.13|conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 521 Score = 24.2 bits (50), Expect = 8.8 Identities = 9/33 (27%), Positives = 19/33 (57%) Frame = +3 Query: 192 LTCYFHEHAESWIPDPISKSRMKILIHLFNVLI 290 +T FH ++ +W P + + IL +F++L+ Sbjct: 155 ITKLFHIYSVNWCPSKLGGTITYILFWMFSLLV 187 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,613,492 Number of Sequences: 5004 Number of extensions: 30708 Number of successful extensions: 70 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 70 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 156095170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -