BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0726 (436 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14214| Best HMM Match : AmoC (HMM E-Value=3.2) 27 6.7 SB_14144| Best HMM Match : MFS_1 (HMM E-Value=0.047) 27 6.7 >SB_14214| Best HMM Match : AmoC (HMM E-Value=3.2) Length = 451 Score = 27.1 bits (57), Expect = 6.7 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +3 Query: 150 DICDSLMDQDIMTPLTCYFHEHAESWIPDPISKS 251 D+C SLM Q T F EHA +WI S S Sbjct: 176 DLCCSLMTQIPRMRHTWDFLEHAPTWISSQTSMS 209 >SB_14144| Best HMM Match : MFS_1 (HMM E-Value=0.047) Length = 355 Score = 27.1 bits (57), Expect = 6.7 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 216 AESWIPDPISKSRMKILIHLFNVLICC 296 A SW D I + +IL+ LF + +CC Sbjct: 215 AFSWYADRIKRFTKRILMGLFVMTVCC 241 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,494,651 Number of Sequences: 59808 Number of extensions: 210232 Number of successful extensions: 391 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 379 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 391 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 834771332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -