BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0726 (436 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z95559-7|CAB76730.2| 329|Caenorhabditis elegans Hypothetical pr... 27 5.9 AF106579-8|AAC78201.1| 710|Caenorhabditis elegans Hypothetical ... 27 7.8 >Z95559-7|CAB76730.2| 329|Caenorhabditis elegans Hypothetical protein Y41E3.14 protein. Length = 329 Score = 27.1 bits (57), Expect = 5.9 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = +3 Query: 186 TPLTCYFHEHAESWIPDPISK 248 TP+ C F+ A +WIP+P+S+ Sbjct: 168 TPIIC-FNSKALAWIPEPLSE 187 >AF106579-8|AAC78201.1| 710|Caenorhabditis elegans Hypothetical protein F54E2.5 protein. Length = 710 Score = 26.6 bits (56), Expect = 7.8 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = +2 Query: 275 VQCVNLLLNLCESSDLXXKYVGQSRILDILPRYLDMAXFGI 397 + C NLL+N+ + L K QS I + +D + I Sbjct: 454 ISCANLLINVPATLSLISKDSVQSEIFSFISHLIDFCHYSI 494 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,804,115 Number of Sequences: 27780 Number of extensions: 167950 Number of successful extensions: 319 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 319 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 319 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 735312162 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -