BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0716 (423 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1786.01c ||SPAC31G5.20c|triacylglycerol lipase|Schizosacchar... 28 0.52 SPCC320.05 |||sulphate transporter |Schizosaccharomyces pombe|ch... 27 0.91 SPAC56E4.07 |||N-acetyltransferase |Schizosaccharomyces pombe|ch... 25 3.7 SPAC27D7.11c |||But2 family protein|Schizosaccharomyces pombe|ch... 25 6.4 SPBC1271.08c |||sequence orphan|Schizosaccharomyces pombe|chr 2|... 25 6.4 SPBC18H10.10c |cwc16||complexed with Cdc5 protein Cwf16|Schizosa... 25 6.4 >SPAC1786.01c ||SPAC31G5.20c|triacylglycerol lipase|Schizosaccharomyces pombe|chr 1|||Manual Length = 630 Score = 28.3 bits (60), Expect = 0.52 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 2/66 (3%) Frame = +2 Query: 29 TEIGSQRDLLIECNRDTSRFNAVLWSRVMCYGDQKE*EFSHGLR*TARI--ISSTGARTR 202 ++IG+ D R +RF+ +LW++ Y + F+ + T RI IS + Sbjct: 315 SDIGNWLDATKRYFRTGARFDEILWAKTCMYFTRGSLTFAEAYKRTGRILNISVIPSDVH 374 Query: 203 SPTMLI 220 SP LI Sbjct: 375 SPPKLI 380 >SPCC320.05 |||sulphate transporter |Schizosaccharomyces pombe|chr 3|||Manual Length = 667 Score = 27.5 bits (58), Expect = 0.91 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = -1 Query: 288 YTGPRASPGVYP*ARIFLVEVTVINMVG 205 Y PR PG P RI +EV V +MVG Sbjct: 569 YGHPRMHPGETPYRRIEDIEVVVFDMVG 596 >SPAC56E4.07 |||N-acetyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 235 Score = 25.4 bits (53), Expect = 3.7 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = +1 Query: 10 PDPAINYRDWL 42 PDP ++YRDW+ Sbjct: 89 PDPNVSYRDWI 99 >SPAC27D7.11c |||But2 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 463 Score = 24.6 bits (51), Expect = 6.4 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +2 Query: 176 ISSTGARTRSPTMLITVTSTRK 241 I+STGA T + T TVTST++ Sbjct: 235 ITSTGASTVTSTQPSTVTSTQR 256 >SPBC1271.08c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 140 Score = 24.6 bits (51), Expect = 6.4 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +2 Query: 344 FSSLEEKSWCTFTTKCWSYCSL 409 FS E +WC T WS+ L Sbjct: 68 FSKWVELAWCFLTLATWSFMKL 89 >SPBC18H10.10c |cwc16||complexed with Cdc5 protein Cwf16|Schizosaccharomyces pombe|chr 2|||Manual Length = 294 Score = 24.6 bits (51), Expect = 6.4 Identities = 8/23 (34%), Positives = 17/23 (73%) Frame = +2 Query: 332 RGKRFSSLEEKSWCTFTTKCWSY 400 +G RF++++++ +TTK WS+ Sbjct: 42 QGTRFNAVKKEIGSYYTTKIWSF 64 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,684,090 Number of Sequences: 5004 Number of extensions: 29903 Number of successful extensions: 89 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 86 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 150383836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -