BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0715 (725 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 24 5.5 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 7.3 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 23.8 bits (49), Expect = 5.5 Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 3/77 (3%) Frame = +2 Query: 131 ITDSLQDMLD-IDIKNEIATDL-SSISDFQDSFGTNFSDMPPLPTWTLIIALR-G*ITVP 301 IT L++M I + + +L S+ F + G FS PP +W +I L G T+ Sbjct: 1138 ITKKLKEMYQMITLGGDAELELVDSMDPFNE--GIVFSVRPPKKSWKMISNLSGGEKTLS 1195 Query: 302 VLFII*IYMDLKPMPLW 352 L ++ KP PL+ Sbjct: 1196 SLALVFALHYYKPSPLY 1212 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.4 bits (48), Expect = 7.3 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +3 Query: 594 GEGRWYLRKNKTTKTV 641 G+GRW +++ T KTV Sbjct: 935 GDGRWTYQQHHTVKTV 950 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 708,469 Number of Sequences: 2352 Number of extensions: 13531 Number of successful extensions: 69 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 69 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -