BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0713 (645 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC191.07 |cyc1||cytochrome c |Schizosaccharomyces pombe|chr 3|... 27 2.3 SPAC4H3.11c |ppc89|mug127|spindle pole body protein Ppc89|Schizo... 27 3.1 SPAC56F8.10 |met9|met5|methylenetetrahydrofolate reductase Met9|... 26 4.0 SPBC1271.03c |||phosphoprotein phosphatase|Schizosaccharomyces p... 26 5.3 SPAC13G7.12c |||choline kinase |Schizosaccharomyces pombe|chr 1|... 25 7.1 SPBC660.17c |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 25 7.1 SPBC16C6.03c |||sequence orphan|Schizosaccharomyces pombe|chr 2|... 25 9.3 >SPCC191.07 |cyc1||cytochrome c |Schizosaccharomyces pombe|chr 3|||Manual Length = 109 Score = 27.1 bits (57), Expect = 2.3 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +2 Query: 335 LEKSRRNNLGPSLHQVLGGKT 397 +EK N +GP+LH V G KT Sbjct: 25 VEKGGANKVGPNLHGVFGRKT 45 >SPAC4H3.11c |ppc89|mug127|spindle pole body protein Ppc89|Schizosaccharomyces pombe|chr 1|||Manual Length = 783 Score = 26.6 bits (56), Expect = 3.1 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = -2 Query: 464 QLNLNFKWTTGRFQHRADIENDKFFHPIPDVKTALDYFYDF 342 Q NLNF+ +G+ R D E FF P+ K+ +F+DF Sbjct: 36 QDNLNFQPRSGK---REDFE--PFFQDTPNTKSLSKHFHDF 71 >SPAC56F8.10 |met9|met5|methylenetetrahydrofolate reductase Met9|Schizosaccharomyces pombe|chr 1|||Manual Length = 603 Score = 26.2 bits (55), Expect = 4.0 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = -2 Query: 404 NDKFFHPIPDVKTALDYFYDFFPEELFSEICE-YTSMYSVQESGRSLNVSI 255 +DK HP D K + Y Y+FFP + + + Y + ++ GR + V + Sbjct: 4 SDKLLHP--DWKEKVTYSYEFFPPKTSTGVQNLYNRIDRMKTWGRPMFVDV 52 >SPBC1271.03c |||phosphoprotein phosphatase|Schizosaccharomyces pombe|chr 2|||Manual Length = 244 Score = 25.8 bits (54), Expect = 5.3 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 290 PNTCLYIHKFQKIVLLEKSRRNNL 361 PN YI+KF +L +KS +NL Sbjct: 200 PNVSYYIYKFPFKILADKSLEDNL 223 >SPAC13G7.12c |||choline kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 456 Score = 25.4 bits (53), Expect = 7.1 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = +2 Query: 281 ILGPNTCLYIHKFQKIVLLEKSRRNNLGPSL 373 I GP+ L+I++ ++ L++ R+N+GP L Sbjct: 94 IYGPHVELFINRQVELENLKRLARHNIGPYL 124 >SPBC660.17c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 172 Score = 25.4 bits (53), Expect = 7.1 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -1 Query: 162 YNPRXPRKWGFKNLVRAGASGVI 94 +NP+ P KW F ++ G + +I Sbjct: 96 FNPKTPNKWKFLFILNIGVTALI 118 >SPBC16C6.03c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 158 Score = 25.0 bits (52), Expect = 9.3 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -2 Query: 527 INEENSRTKPHNQARHAVRKKQLNLNFKWT 438 + ++NS ++ N RH R+ +L+FK T Sbjct: 30 LTQKNSSSETENVGRHGKRRMDQDLSFKPT 59 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,756,113 Number of Sequences: 5004 Number of extensions: 58753 Number of successful extensions: 166 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 164 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 166 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 289756512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -