BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0713 (645 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0756 + 19314669-19315085 30 1.8 01_06_1089 - 34451982-34452670,34452755-34452814,34453287-344533... 29 4.2 11_02_0047 + 7716315-7716420,7716518-7716647,7716785-7716856,771... 28 5.5 03_05_0725 + 27155736-27155746,27155798-27155949,27156108-271580... 28 7.3 02_01_0336 + 2397648-2397812,2398367-2398441,2398860-2398975,239... 28 7.3 >04_03_0756 + 19314669-19315085 Length = 138 Score = 29.9 bits (64), Expect = 1.8 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +3 Query: 54 GYRIVTGYPFHLYK*PQMLRLVPNF*NPTFGVFVDCIVFFF 176 G R H Y QM +++P TFGVF +C +FF Sbjct: 87 GIRFAFTAAMHYYHCTQM-QMMPELTRTTFGVFYNCFHYFF 126 >01_06_1089 - 34451982-34452670,34452755-34452814,34453287-34453352, 34454055-34454253,34454470-34454719,34454830-34454898, 34455733-34455804,34456027-34456168,34456544-34457064, 34457166-34457739,34459164-34459269 Length = 915 Score = 28.7 bits (61), Expect = 4.2 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = -2 Query: 374 VKTALDYFYDFFPEELFSEICEYTSMYSVQESGRSLNVSIEKCA 243 V+T++ DF PEE+FS C S Q+ R+ + +C+ Sbjct: 565 VETSIAESKDFLPEEIFS--CHGRDNISTQKPHRAAGYGVRRCS 606 >11_02_0047 + 7716315-7716420,7716518-7716647,7716785-7716856, 7717007-7717078,7717274-7717345,7717684-7717845, 7718105-7718176,7718435-7718503,7718788-7718859, 7718992-7719129,7719386-7719888,7720007-7720171, 7720267-7720403,7720488-7720707,7720793-7721028, 7721165-7721632 Length = 897 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +1 Query: 67 LPDIRFISINNPRCSGSYQIFKTPLSGXSWIVL 165 LP +RF+S+NN R +GS LS W+ L Sbjct: 145 LPKLRFLSLNNNRFTGSIPPSIGNLSNMYWLDL 177 >03_05_0725 + 27155736-27155746,27155798-27155949,27156108-27158068, 27159169-27159397,27159506-27159634,27159725-27159838, 27160059-27160258,27160301-27160599,27160713-27160923, 27161017-27161172,27161290-27161447,27161532-27161724, 27162015-27162406,27162537-27162717,27162802-27163031, 27163108-27163753,27163833-27163902,27163994-27164244 Length = 1860 Score = 27.9 bits (59), Expect = 7.3 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = -3 Query: 358 IISTTFFQKNYFLKFVNIQACIRSKNQDVR*TCLLRNAHIYSDQ 227 I T ++YF+KF+ + R QD C L A +Y DQ Sbjct: 349 IAQTNIPFQDYFVKFIELDKITRGWAQDRSAQCSLFLAELYYDQ 392 >02_01_0336 + 2397648-2397812,2398367-2398441,2398860-2398975, 2399155-2399269,2399360-2399488,2399809-2399856, 2400369-2400448,2400628-2400824,2400916-2401202, 2401281-2401307,2401353-2401538,2401633-2402094, 2402201-2402350,2402612-2402687,2402851-2402978, 2403244-2403435,2403559-2403690,2403767-2403889, 2404128-2404346,2404518-2404679 Length = 1022 Score = 27.9 bits (59), Expect = 7.3 Identities = 16/57 (28%), Positives = 24/57 (42%) Frame = -2 Query: 362 LDYFYDFFPEELFSEICEYTSMYSVQESGRSLNVSIEKCAHL*RSNFLWALQHFHHI 192 +D Y F EEL ++CE + +E L S + S +W + F HI Sbjct: 158 VDGTYQFNLEELVPKLCELAQIVKAEEKDNMLRASTLQAL----SAMIWFMGEFSHI 210 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,626,814 Number of Sequences: 37544 Number of extensions: 332406 Number of successful extensions: 670 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 659 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 670 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1596695220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -