BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0711 (733 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 28 0.079 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 28 0.079 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 26 0.42 AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. 22 6.8 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 21 9.0 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 21 9.0 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 9.0 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 21 9.0 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 28.3 bits (60), Expect = 0.079 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -2 Query: 339 SLHTQQGVCRLKLPPRRTPPCFCHERASD*LNEGC 235 S+ + G+ +K P R+PP F H R +++ C Sbjct: 454 SVSGEAGIEEVKSPVLRSPPAFSHSRCPPEIHKSC 488 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 28.3 bits (60), Expect = 0.079 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -2 Query: 339 SLHTQQGVCRLKLPPRRTPPCFCHERASD*LNEGC 235 S+ + G+ +K P R+PP F H R +++ C Sbjct: 454 SVSGEAGIEEVKSPVLRSPPAFSHSRCPPEIHKSC 488 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 25.8 bits (54), Expect = 0.42 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 497 GLVGFLTPFEFNNFQEQVMNVLEGHAALTL 586 G VGF+TPFE +F + + L +A L + Sbjct: 978 GRVGFVTPFEHRHFISGIDSNLHVYAPLKI 1007 >AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. Length = 148 Score = 21.8 bits (44), Expect = 6.8 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +3 Query: 213 GSRRPDTGTLRSASHWLVHD 272 GS P+ G + + W VHD Sbjct: 38 GSYGPEAGNVSCSVSWEVHD 57 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.4 bits (43), Expect = 9.0 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = -3 Query: 122 FIILPHGPNCCIGD 81 ++I+P P+CC D Sbjct: 347 YVIVPFCPDCCPSD 360 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.4 bits (43), Expect = 9.0 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = -3 Query: 122 FIILPHGPNCCIGD 81 ++I+P P+CC D Sbjct: 347 YVIVPFCPDCCPSD 360 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -2 Query: 333 HTQQGVCRLKLPPRRTPP 280 H Q PPR+TPP Sbjct: 384 HWQMSCVACSPPPRQTPP 401 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 21.4 bits (43), Expect = 9.0 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = -3 Query: 122 FIILPHGPNCCIGD 81 ++I+P P+CC D Sbjct: 347 YVIVPFCPDCCPSD 360 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 204,155 Number of Sequences: 438 Number of extensions: 4273 Number of successful extensions: 12 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22779405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -