BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0709 (615 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0177 + 21557762-21559658,21563481-21563623,21564230-21564559 30 1.7 02_03_0262 + 17015383-17015619,17017932-17018879 28 5.1 03_02_1023 + 13265179-13265330,13265526-13265637,13265752-132660... 27 8.9 01_06_0767 + 31823659-31823734,31823859-31823979,31824078-318241... 27 8.9 >03_05_0177 + 21557762-21559658,21563481-21563623,21564230-21564559 Length = 789 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = -2 Query: 602 STTHKDKLKKHQTXCFLGKGIAIRIPGTPSDRSMPPPYY 486 S++H+ K K+H++ + + IPG P +PPPY+ Sbjct: 735 SSSHEHKNKRHRSNQAMPRWENQTIPGPPVYFPVPPPYF 773 >02_03_0262 + 17015383-17015619,17017932-17018879 Length = 394 Score = 28.3 bits (60), Expect = 5.1 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +3 Query: 252 REPAGSI*AQSNTGSTKSSAS*NPLPDRNSDPPKTTRSN 368 R PAG AQ+N+ + ++A+ + LP +S P K SN Sbjct: 235 RTPAGESSAQNNSIAAAAAAAVSVLPTISSQPSKRKASN 273 >03_02_1023 + 13265179-13265330,13265526-13265637,13265752-13266048, 13266361-13266623,13267637-13267847,13268420-13268590, 13268671-13268748,13269275-13269520,13269763-13271868, 13272122-13273904,13274113-13274216,13274752-13275108, 13275210-13275328,13276175-13276436,13276669-13276893, 13277075-13277214,13278087-13278159,13278431-13278532, 13278647-13279018,13279183-13279230,13279516-13279900, 13280440-13280558 Length = 2574 Score = 27.5 bits (58), Expect = 8.9 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +3 Query: 282 SNTGSTKSSAS*NPLPDRNSDPPKTTRSN 368 SN G+ SS PL ++SDPPK T+S+ Sbjct: 1764 SNDGTLSSS----PLASQSSDPPKQTKSS 1788 >01_06_0767 + 31823659-31823734,31823859-31823979,31824078-31824189, 31824278-31824691,31824795-31824898,31825017-31825136, 31825344-31825467,31826567-31826680,31826789-31826980, 31827328-31827424,31827505-31827653,31828729-31829013 Length = 635 Score = 27.5 bits (58), Expect = 8.9 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -2 Query: 407 CRNRIRNTIRKFPIRSCGLRWIAIPIR 327 C+ ++I+KFP +SC LR+ + I+ Sbjct: 394 CKKNKSDSIKKFPSKSCPLRYGTVKIQ 420 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,240,639 Number of Sequences: 37544 Number of extensions: 324448 Number of successful extensions: 736 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 726 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 736 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1478421500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -