BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0709 (615 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 23 3.1 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 23 3.1 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 23 3.1 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 23 3.1 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 23 3.1 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 23 3.1 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 23 3.1 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 23 3.1 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 23 3.1 S76959-1|AAB33934.1| 85|Apis mellifera olfactory receptor prot... 21 7.2 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 21 7.2 DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse tr... 21 9.6 DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse tr... 21 9.6 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 21 9.6 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 9.6 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 9.6 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 9.6 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 22.6 bits (46), Expect = 3.1 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -2 Query: 527 PGTPSDRSMPPPYYLSHP 474 P TP R +PP Y HP Sbjct: 147 PPTPFPRFIPPNAYRFHP 164 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 22.6 bits (46), Expect = 3.1 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -2 Query: 527 PGTPSDRSMPPPYYLSHP 474 P TP R +PP Y HP Sbjct: 147 PPTPFPRFIPPNAYRFHP 164 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 22.6 bits (46), Expect = 3.1 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -2 Query: 527 PGTPSDRSMPPPYYLSHP 474 P TP R +PP Y HP Sbjct: 147 PPTPFPRFIPPNAYRFHP 164 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 22.6 bits (46), Expect = 3.1 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -2 Query: 527 PGTPSDRSMPPPYYLSHP 474 P TP R +PP Y HP Sbjct: 147 PPTPFPRFIPPNAYRFHP 164 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 3.1 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -2 Query: 527 PGTPSDRSMPPPYYLSHP 474 P TP R +PP Y HP Sbjct: 151 PPTPFPRFIPPNAYRFHP 168 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.6 bits (46), Expect = 3.1 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -2 Query: 527 PGTPSDRSMPPPYYLSHP 474 P TP R +PP Y HP Sbjct: 156 PPTPFPRFIPPNAYRFHP 173 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.6 bits (46), Expect = 3.1 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -2 Query: 527 PGTPSDRSMPPPYYLSHP 474 P TP R +PP Y HP Sbjct: 156 PPTPFPRFIPPNAYRFHP 173 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.6 bits (46), Expect = 3.1 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -2 Query: 527 PGTPSDRSMPPPYYLSHP 474 P TP R +PP Y HP Sbjct: 156 PPTPFPRFIPPNAYRFHP 173 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 22.6 bits (46), Expect = 3.1 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = -2 Query: 608 FASTTHKDKLKKHQTXCFLGKGIAIRIPGTPSDRSMPP 495 F S +D+L + + G A RI G+P+ + PP Sbjct: 419 FPSLDSRDELHPRELEA-VNLGSACRIHGSPATTAAPP 455 >S76959-1|AAB33934.1| 85|Apis mellifera olfactory receptor protein. Length = 85 Score = 21.4 bits (43), Expect = 7.2 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 158 SAAEISMKMAATCGAHI 108 S+AE K TCG+HI Sbjct: 41 SSAEGWFKAIGTCGSHI 57 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 21.4 bits (43), Expect = 7.2 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -3 Query: 94 TVRASVSIKTKKVCPN 47 TVRASV IK K+ N Sbjct: 277 TVRASVHIKLPKLAAN 292 >DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse transcriptase protein. Length = 127 Score = 21.0 bits (42), Expect = 9.6 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 56 DLFSFYRNRSSNCYKIIK 109 DLF N N +KIIK Sbjct: 50 DLFDNVHNHIQNIFKIIK 67 >DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse transcriptase protein. Length = 110 Score = 21.0 bits (42), Expect = 9.6 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 56 DLFSFYRNRSSNCYKIIK 109 DLF N N +KIIK Sbjct: 33 DLFDNVHNHIQNIFKIIK 50 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/38 (21%), Positives = 20/38 (52%) Frame = -3 Query: 115 LTFNDFVTVRASVSIKTKKVCPNPSQWLSSTLASIMNN 2 L + F + ++ K +++ W+S+T + ++NN Sbjct: 323 LALSVFALILTALLRKMQEMSIEVPYWISTTTSFVLNN 360 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -1 Query: 582 IEKAPNPXFSRQGYRDSHSGYT 517 +E N GY+DS +G+T Sbjct: 487 LEDLRNKKSCHSGYKDSFAGWT 508 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -1 Query: 582 IEKAPNPXFSRQGYRDSHSGYT 517 +E N GY+DS +G+T Sbjct: 487 LEDLRNKKSCHSGYKDSFAGWT 508 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -1 Query: 582 IEKAPNPXFSRQGYRDSHSGYT 517 +E N GY+DS +G+T Sbjct: 487 LEDLRNKKSCHSGYKDSFAGWT 508 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,995 Number of Sequences: 438 Number of extensions: 3768 Number of successful extensions: 22 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18215697 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -