BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0708 (654 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1486.10 |thi1|ntf1, SPAC6G10.01|transcription factor Thi1|Sc... 26 4.1 SPBC21C3.03 |||ABC1 kinase family protein|Schizosaccharomyces po... 26 5.5 SPBC1A4.02c |leu1|SPBC1E8.07c|3-isopropylmalate dehydrogenase Le... 26 5.5 SPBC25B2.07c |mug164||microtubule-associated protein|Schizosacch... 25 7.2 SPAPB17E12.02 |yip12|yip1, yip1-b|SMN family protein Yip12|Schiz... 25 7.2 SPAC19B12.12c |yip11|yip1, yip1-a|SMN family protein Yip11|Schiz... 25 7.2 SPBC19C2.09 |sre1||sterol regulatory element binding protein Sre... 25 9.5 >SPAC1486.10 |thi1|ntf1, SPAC6G10.01|transcription factor Thi1|Schizosaccharomyces pombe|chr 1|||Manual Length = 775 Score = 26.2 bits (55), Expect = 4.1 Identities = 12/54 (22%), Positives = 28/54 (51%) Frame = +3 Query: 108 IITSVRDMGSRGKSRIPTQQQARHSSSIVRSRCQTR*IKCDTGGSHVTTEAVKL 269 + V+D+ + K R+P +Q+ R + C+ + IKC+ G ++ + + + Sbjct: 12 LFADVKDLERKKKRRVPPEQRRRVFRAC--KHCRQKKIKCNGGQPCISCKTLNI 63 >SPBC21C3.03 |||ABC1 kinase family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 674 Score = 25.8 bits (54), Expect = 5.5 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +3 Query: 279 VLKVGESRHVRLDIEFPDAPVTFTLVQGSG 368 V+ + HVR++ F + ++ LV+G+G Sbjct: 578 VMTMAREHHVRIEANFANTVLSILLVEGAG 607 >SPBC1A4.02c |leu1|SPBC1E8.07c|3-isopropylmalate dehydrogenase Leu1|Schizosaccharomyces pombe|chr 2|||Manual Length = 371 Score = 25.8 bits (54), Expect = 5.5 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +3 Query: 237 GSHVTTEAVKLPVAVLKVGESRHVRLDIEFPD 332 G H+ E V + VLKV E + L +EF + Sbjct: 11 GDHIGPEIVASALEVLKVVEKKRPELKLEFEE 42 >SPBC25B2.07c |mug164||microtubule-associated protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 501 Score = 25.4 bits (53), Expect = 7.2 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = -3 Query: 385 PIKCTGPEP*TRVNVTGASGNSMSRRTCLDSPTFNTAT 272 P + + P +RVNVT ASG+ T N +T Sbjct: 240 PTRTSTTRPLSRVNVTNASGSISKNSTSPSKVKVNAST 277 >SPAPB17E12.02 |yip12|yip1, yip1-b|SMN family protein Yip12|Schizosaccharomyces pombe|chr 1|||Manual Length = 235 Score = 25.4 bits (53), Expect = 7.2 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -1 Query: 174 ELVAAWVFCFCLWIP 130 +L + W+FCFC +P Sbjct: 170 DLQSQWIFCFCYKLP 184 >SPAC19B12.12c |yip11|yip1, yip1-a|SMN family protein Yip11|Schizosaccharomyces pombe|chr 1|||Manual Length = 235 Score = 25.4 bits (53), Expect = 7.2 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -1 Query: 174 ELVAAWVFCFCLWIP 130 +L + W+FCFC +P Sbjct: 170 DLQSQWIFCFCYKLP 184 >SPBC19C2.09 |sre1||sterol regulatory element binding protein Sre1|Schizosaccharomyces pombe|chr 2|||Manual Length = 900 Score = 25.0 bits (52), Expect = 9.5 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +1 Query: 103 LSSSHQSETWDPEAKAEYPRSNKLVIRQALLGPDAKPDELNVIQVEA 243 L +S ++ + + AE KL+ Q L+G DAK D L ++ V A Sbjct: 536 LYTSSENWVYSEQQLAEVRNMEKLLDAQ-LMGGDAKVDRLRLLMVFA 581 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,427,390 Number of Sequences: 5004 Number of extensions: 43059 Number of successful extensions: 101 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 97 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 101 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 295793106 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -