BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0704 (467 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1259.13 |chk1|rad27|Chk1 protein kinase|Schizosaccharomyces ... 28 0.62 SPCC1840.02c |bgs4|orb11, cwg1|1,3-beta-glucan synthase subunit ... 25 4.4 SPAC16A10.03c |||zinc finger protein Pep5/Vps11 |Schizosaccharom... 25 4.4 SPAC6F12.15c |cut9|dre1|anaphase-promoting complex subunit Cut9|... 25 4.4 SPAC22F8.08 |||COPII vesicle coat protein |Schizosaccharomyces p... 25 5.8 SPBC1198.02 |dea2||adenine deaminase Dea2|Schizosaccharomyces po... 25 5.8 SPAC25B8.13c |isp7||2-OG-Fe|Schizosaccharomyces pombe|chr 1|||Ma... 25 7.6 >SPCC1259.13 |chk1|rad27|Chk1 protein kinase|Schizosaccharomyces pombe|chr 3|||Manual Length = 496 Score = 28.3 bits (60), Expect = 0.62 Identities = 19/60 (31%), Positives = 26/60 (43%) Frame = +3 Query: 228 LNRVITTGENFASAHRMLCISLKTRMQKTVKASSRHAEDWSQAPVFVRRQGTSAQLEPLC 407 + R I TG FAS LC ++ + +HA A V+ RR + QL LC Sbjct: 12 IGREIGTGA-FASVR--LCYDDNAKIYAVKFVNKKHATSCMNAGVWARRMASEIQLHKLC 68 >SPCC1840.02c |bgs4|orb11, cwg1|1,3-beta-glucan synthase subunit Bgs4|Schizosaccharomyces pombe|chr 3|||Manual Length = 1955 Score = 25.4 bits (53), Expect = 4.4 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 Query: 206 IFISCTRPQPCDHYWGKLRLC 268 I +S RP C YW RLC Sbjct: 714 IVLSTMRPYLCSIYWAGSRLC 734 >SPAC16A10.03c |||zinc finger protein Pep5/Vps11 |Schizosaccharomyces pombe|chr 1|||Manual Length = 860 Score = 25.4 bits (53), Expect = 4.4 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +1 Query: 31 LYKFVEICTMEWMVPVNEML 90 LYK +E C M++ +P+ +L Sbjct: 714 LYKILEACFMQFRIPIQHVL 733 >SPAC6F12.15c |cut9|dre1|anaphase-promoting complex subunit Cut9|Schizosaccharomyces pombe|chr 1|||Manual Length = 671 Score = 25.4 bits (53), Expect = 4.4 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -2 Query: 388 ALVPCRRTKTGACDQSSACRLLAFTVFCILVFKD 287 A C TK ++SSACR LA FC++ D Sbjct: 134 ARAKCLLTKEDLYNRSSACRYLA--AFCLVKLYD 165 >SPAC22F8.08 |||COPII vesicle coat protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 926 Score = 25.0 bits (52), Expect = 5.8 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -3 Query: 330 DCSPSPFFASWSLRIYTTCDGQRR 259 D PF + + ++TTC+G+RR Sbjct: 620 DTITKPFVSFQTAMLHTTCNGERR 643 >SPBC1198.02 |dea2||adenine deaminase Dea2|Schizosaccharomyces pombe|chr 2|||Manual Length = 367 Score = 25.0 bits (52), Expect = 5.8 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -1 Query: 404 ERLQLRTCSLSSNKNRCLRPIFSMPTARLHRFLHPGL 294 E + L C LS+ K RC+ I +P + FL G+ Sbjct: 250 ENIMLTMCPLSNLKLRCVNSIAELP---VREFLEAGV 283 >SPAC25B8.13c |isp7||2-OG-Fe|Schizosaccharomyces pombe|chr 1|||Manual Length = 397 Score = 24.6 bits (51), Expect = 7.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 245 YWGKLRLCPSHVVYILKDQDAKNGEG 322 Y G+ L PS + Y+L NGEG Sbjct: 131 YPGEAPLPPSSIGYVLPPSSLANGEG 156 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,886,000 Number of Sequences: 5004 Number of extensions: 35390 Number of successful extensions: 90 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 90 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 90 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 178394480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -