BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0704 (467 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 8.7 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 21 8.7 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 20.6 bits (41), Expect = 8.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +1 Query: 139 EGNIRTVRMLQDSLSKLIDVLENI 210 E + + + D S+LID LEN+ Sbjct: 352 EAEKKNLSKVIDQHSQLIDTLENV 375 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 20.6 bits (41), Expect = 8.7 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -1 Query: 401 RLQLRTCSLSSNKNRCLRPIFSMPTARLHRFLHP 300 R Q L SN+NR + ++ + H FL+P Sbjct: 342 REQYSQSHLISNENRDFQTTPTVSVEQPHLFLYP 375 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 128,252 Number of Sequences: 438 Number of extensions: 2612 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12559158 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -