BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0696 (419 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 22 2.8 DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 pro... 21 6.4 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 20 8.5 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 20 8.5 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 21.8 bits (44), Expect = 2.8 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +3 Query: 249 EGIFKRAEQYVKEYRIKERDEIRLARQARNRGNY 350 +G FKR + Y +E + ++ RNR Y Sbjct: 107 KGFFKRTVRKDLSYACREEKNCIIDKRQRNRCQY 140 >DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 protein. Length = 377 Score = 20.6 bits (41), Expect = 6.4 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +1 Query: 322 PDKHAIVATTTFPGKP 369 P KH + T PG+P Sbjct: 267 PSKHGLNDATAAPGEP 282 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 20.2 bits (40), Expect = 8.5 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 252 GIFKRAEQYVKEYRIKERDE 311 G FKR+ + ++Y K +DE Sbjct: 60 GFFKRSIRRNRQYVCKAKDE 79 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 20.2 bits (40), Expect = 8.5 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 252 GIFKRAEQYVKEYRIKERDE 311 G FKR+ + ++Y K +DE Sbjct: 60 GFFKRSIRRNRQYVCKAKDE 79 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 75,203 Number of Sequences: 336 Number of extensions: 1211 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 9279512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -