BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0694 (676 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37452| Best HMM Match : zf-C2H2 (HMM E-Value=0) 31 0.85 SB_32794| Best HMM Match : Gam (HMM E-Value=5.8) 30 2.0 SB_21193| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_39193| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.029) 28 6.0 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_49606| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 >SB_37452| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 211 Score = 31.1 bits (67), Expect = 0.85 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -3 Query: 293 RIHRGPSR-KVDELATCRSNAGFIVVYYLEHCGRFP 189 R+H+G R + + C S AG++ V+Y H G P Sbjct: 24 RLHKGEKRYQCQQCGKCFSKAGYLTVHYRYHTGERP 59 >SB_32794| Best HMM Match : Gam (HMM E-Value=5.8) Length = 511 Score = 29.9 bits (64), Expect = 2.0 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -3 Query: 506 QSDSLQCPNGNLLLTPLD*HLIFQPWSRVK 417 +SDSL+CP+ N L+ D +F W+ +K Sbjct: 470 ESDSLECPSHNELIHNEDKEEVFDEWNLIK 499 >SB_21193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 29.9 bits (64), Expect = 2.0 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -3 Query: 506 QSDSLQCPNGNLLLTPLD*HLIFQPWSRVK 417 +SDSL+CP+ N L+ D +F W+ +K Sbjct: 280 ESDSLECPSHNELIHNEDKEEVFDEWNLIK 309 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +3 Query: 93 NKIFSDFQKNLDQEQELRETIRTICKEVDQISRE 194 N + N ++ Q+LRE ICKE +Q+ RE Sbjct: 1299 NTSLEEKDNNEEEVQQLREWYDVICKEKEQLERE 1332 >SB_39193| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.029) Length = 1769 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/48 (22%), Positives = 27/48 (56%) Frame = +3 Query: 57 IKHVKMCDNELINKIFSDFQKNLDQEQELRETIRTICKEVDQISREAT 200 I ++ D+E++ + D +K LD+ E+R + I +++++ + T Sbjct: 1279 IATLRALDDEILKLLVEDLEKFLDEVDEMRGKLHKIVFKIEELLSQKT 1326 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +1 Query: 280 PRWIRKTERCCTTNRLLQVSGSLEIHDPTLLLSDSAHYMARE 405 P W ++E T + V GS++ P LLL + H + RE Sbjct: 416 PMWFSESEDSTVTEIVESVGGSVDATQPKLLLRQTQH-LVRE 456 >SB_49606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/58 (27%), Positives = 30/58 (51%), Gaps = 3/58 (5%) Frame = +3 Query: 75 CDNELINKIFSDFQKNLDQEQELRE---TIRTICKEVDQISREATTVLQVIHYNEAGI 239 CD L + + ++ LD E+EL E T ++ KE+D + ++A + + EA + Sbjct: 180 CDQGLFDHVCQLRERRLDLEEELAEEKKTSESLKKELDALVKKAKVIDSALKTAEADL 237 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,537,502 Number of Sequences: 59808 Number of extensions: 391420 Number of successful extensions: 1040 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 971 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1040 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1733301648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -