BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0691 (506 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U95000-1|AAF88143.1| 2798|Homo sapiens hyd protein protein. 79 7e-15 AF006010-1|AAD01259.2| 2799|Homo sapiens progestin induced prote... 78 2e-14 AB020703-1|BAA74919.3| 2820|Homo sapiens KIAA0896 protein protein. 78 2e-14 Z48501-1|CAA88401.1| 522|Homo sapiens polyadenylate binding pro... 29 9.3 Y00345-1|CAA68428.1| 633|Homo sapiens protein ( Human mRNA for ... 29 9.3 U68104-1|AAD08718.1| 636|Homo sapiens poly(A)-binding protein p... 29 9.3 DQ120640-1|ABB92425.1| 630|Homo sapiens PABP3 protein. 29 9.3 BC045608-1|AAH45608.1| 631|Homo sapiens poly(A) binding protein... 29 9.3 BC041863-1|AAH41863.1| 636|Homo sapiens poly(A) binding protein... 29 9.3 BC027617-1|AAH27617.1| 631|Homo sapiens poly(A) binding protein... 29 9.3 BC023520-1|AAH23520.1| 636|Homo sapiens poly(A) binding protein... 29 9.3 BC015958-1|AAH15958.1| 636|Homo sapiens PABPC1 protein protein. 29 9.3 AL359757-1|CAH70805.1| 631|Homo sapiens poly(A) binding protein... 29 9.3 AL109839-10|CAI95639.1| 168|Homo sapiens chromosome 20 open rea... 29 9.3 AL109839-9|CAI95638.1| 171|Homo sapiens chromosome 20 open read... 29 9.3 AL109839-8|CAI95637.1| 149|Homo sapiens chromosome 20 open read... 29 9.3 AL109839-7|CAI95636.1| 151|Homo sapiens chromosome 20 open read... 29 9.3 AL109839-1|CAI95631.1| 614|Homo sapiens chromosome 20 open read... 29 9.3 AL008725-4|CAI95662.1| 614|Homo sapiens chromosome 20 open read... 29 9.3 AF307451-1|AAK30049.1| 578|Homo sapiens Cat eye syndrome critic... 29 9.3 AF132026-1|AAG38953.1| 631|Homo sapiens testis-specific poly(A)... 29 9.3 >U95000-1|AAF88143.1| 2798|Homo sapiens hyd protein protein. Length = 2798 Score = 79.4 bits (187), Expect = 7e-15 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = +3 Query: 6 AQPPLAVNRVKVTFRDEPGEGSGVARSFYTSVAEALLANEKLPPLE 143 A P+AV+RVKVTFRDEPGEGSGVARSFYT++A+A L+NEKLP LE Sbjct: 2267 ATTPMAVHRVKVTFRDEPGEGSGVARSFYTAIAQAFLSNEKLPNLE 2312 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = +1 Query: 427 EHLTHHQAQLGERLYPRVHSLHPTFA 504 E L H+ LGERLYPRV ++ P FA Sbjct: 2387 EPLPAHRQALGERLYPRVQAMQPAFA 2412 >AF006010-1|AAD01259.2| 2799|Homo sapiens progestin induced protein protein. Length = 2799 Score = 78.2 bits (184), Expect = 2e-14 Identities = 35/46 (76%), Positives = 42/46 (91%) Frame = +3 Query: 6 AQPPLAVNRVKVTFRDEPGEGSGVARSFYTSVAEALLANEKLPPLE 143 A P+AV+RVKVTF+DEPGEGSGVARSFYT++A+A L+NEKLP LE Sbjct: 2268 ATTPMAVHRVKVTFKDEPGEGSGVARSFYTAIAQAFLSNEKLPNLE 2313 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = +1 Query: 427 EHLTHHQAQLGERLYPRVHSLHPTFA 504 E L H+ LGERLYPRV ++ P FA Sbjct: 2388 EPLPAHRQALGERLYPRVQAMQPAFA 2413 >AB020703-1|BAA74919.3| 2820|Homo sapiens KIAA0896 protein protein. Length = 2820 Score = 78.2 bits (184), Expect = 2e-14 Identities = 35/46 (76%), Positives = 42/46 (91%) Frame = +3 Query: 6 AQPPLAVNRVKVTFRDEPGEGSGVARSFYTSVAEALLANEKLPPLE 143 A P+AV+RVKVTF+DEPGEGSGVARSFYT++A+A L+NEKLP LE Sbjct: 2290 ATTPMAVHRVKVTFKDEPGEGSGVARSFYTAIAQAFLSNEKLPNLE 2335 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = +1 Query: 427 EHLTHHQAQLGERLYPRVHSLHPTFA 504 E L H+ LGERLYPRV ++ P FA Sbjct: 2410 EPLPAHRQALGERLYPRVQAMQPAFA 2435 >Z48501-1|CAA88401.1| 522|Homo sapiens polyadenylate binding protein II protein. Length = 522 Score = 29.1 bits (62), Expect = 9.3 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +1 Query: 454 LGERLYPRVHSLHPTFA 504 LGERL+P + ++HPT A Sbjct: 448 LGERLFPLIQAMHPTLA 464 >Y00345-1|CAA68428.1| 633|Homo sapiens protein ( Human mRNA for polyA binding protein. ). Length = 633 Score = 29.1 bits (62), Expect = 9.3 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +1 Query: 454 LGERLYPRVHSLHPTFA 504 LGERL+P + ++HPT A Sbjct: 559 LGERLFPLIQAMHPTLA 575 >U68104-1|AAD08718.1| 636|Homo sapiens poly(A)-binding protein protein. Length = 636 Score = 29.1 bits (62), Expect = 9.3 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +1 Query: 454 LGERLYPRVHSLHPTFA 504 LGERL+P + ++HPT A Sbjct: 562 LGERLFPLIQAMHPTLA 578 >DQ120640-1|ABB92425.1| 630|Homo sapiens PABP3 protein. Length = 630 Score = 29.1 bits (62), Expect = 9.3 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +1 Query: 454 LGERLYPRVHSLHPTFA 504 LGERL+P + ++HPT A Sbjct: 557 LGERLFPLIQAMHPTLA 573 >BC045608-1|AAH45608.1| 631|Homo sapiens poly(A) binding protein, cytoplasmic 3 protein. Length = 631 Score = 29.1 bits (62), Expect = 9.3 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +1 Query: 454 LGERLYPRVHSLHPTFA 504 LGERL+P + ++HPT A Sbjct: 557 LGERLFPLIQAMHPTLA 573 >BC041863-1|AAH41863.1| 636|Homo sapiens poly(A) binding protein, cytoplasmic 1 protein. Length = 636 Score = 29.1 bits (62), Expect = 9.3 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +1 Query: 454 LGERLYPRVHSLHPTFA 504 LGERL+P + ++HPT A Sbjct: 562 LGERLFPLIQAMHPTLA 578 >BC027617-1|AAH27617.1| 631|Homo sapiens poly(A) binding protein, cytoplasmic 3 protein. Length = 631 Score = 29.1 bits (62), Expect = 9.3 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +1 Query: 454 LGERLYPRVHSLHPTFA 504 LGERL+P + ++HPT A Sbjct: 557 LGERLFPLIQAMHPTLA 573 >BC023520-1|AAH23520.1| 636|Homo sapiens poly(A) binding protein, cytoplasmic 1 protein. Length = 636 Score = 29.1 bits (62), Expect = 9.3 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +1 Query: 454 LGERLYPRVHSLHPTFA 504 LGERL+P + ++HPT A Sbjct: 562 LGERLFPLIQAMHPTLA 578 >BC015958-1|AAH15958.1| 636|Homo sapiens PABPC1 protein protein. Length = 636 Score = 29.1 bits (62), Expect = 9.3 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +1 Query: 454 LGERLYPRVHSLHPTFA 504 LGERL+P + ++HPT A Sbjct: 562 LGERLFPLIQAMHPTLA 578 >AL359757-1|CAH70805.1| 631|Homo sapiens poly(A) binding protein, cytoplasmic 3 protein. Length = 631 Score = 29.1 bits (62), Expect = 9.3 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +1 Query: 454 LGERLYPRVHSLHPTFA 504 LGERL+P + ++HPT A Sbjct: 557 LGERLFPLIQAMHPTLA 573 >AL109839-10|CAI95639.1| 168|Homo sapiens chromosome 20 open reading frame 119 protein. Length = 168 Score = 29.1 bits (62), Expect = 9.3 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = +1 Query: 439 HHQAQL-GERLYPRVHSLHPTFA 504 H Q Q+ GERLYP +H +H A Sbjct: 96 HEQKQMIGERLYPLIHDVHTQLA 118 >AL109839-9|CAI95638.1| 171|Homo sapiens chromosome 20 open reading frame 119 protein. Length = 171 Score = 29.1 bits (62), Expect = 9.3 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = +1 Query: 439 HHQAQL-GERLYPRVHSLHPTFA 504 H Q Q+ GERLYP +H +H A Sbjct: 96 HEQKQMIGERLYPLIHDVHTQLA 118 >AL109839-8|CAI95637.1| 149|Homo sapiens chromosome 20 open reading frame 119 protein. Length = 149 Score = 29.1 bits (62), Expect = 9.3 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = +1 Query: 439 HHQAQL-GERLYPRVHSLHPTFA 504 H Q Q+ GERLYP +H +H A Sbjct: 96 HEQKQMIGERLYPLIHDVHTQLA 118 >AL109839-7|CAI95636.1| 151|Homo sapiens chromosome 20 open reading frame 119 protein. Length = 151 Score = 29.1 bits (62), Expect = 9.3 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = +1 Query: 439 HHQAQL-GERLYPRVHSLHPTFA 504 H Q Q+ GERLYP +H +H A Sbjct: 77 HEQKQMIGERLYPLIHDVHTQLA 99 >AL109839-1|CAI95631.1| 614|Homo sapiens chromosome 20 open reading frame 119 protein. Length = 614 Score = 29.1 bits (62), Expect = 9.3 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = +1 Query: 439 HHQAQL-GERLYPRVHSLHPTFA 504 H Q Q+ GERLYP +H +H A Sbjct: 542 HEQKQMIGERLYPLIHDVHTQLA 564 >AL008725-4|CAI95662.1| 614|Homo sapiens chromosome 20 open reading frame 119 protein. Length = 614 Score = 29.1 bits (62), Expect = 9.3 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = +1 Query: 439 HHQAQL-GERLYPRVHSLHPTFA 504 H Q Q+ GERLYP +H +H A Sbjct: 542 HEQKQMIGERLYPLIHDVHTQLA 564 >AF307451-1|AAK30049.1| 578|Homo sapiens Cat eye syndrome critical region candidate gene number 6 protein. Length = 578 Score = 29.1 bits (62), Expect = 9.3 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +1 Query: 376 SRXRRAGYSGERSGGHNEHLTHHQA 450 SR RR G + SG HN HL HH A Sbjct: 249 SRGRRGGAA---SGAHNHHLHHHHA 270 >AF132026-1|AAG38953.1| 631|Homo sapiens testis-specific poly(A)-binding protein protein. Length = 631 Score = 29.1 bits (62), Expect = 9.3 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +1 Query: 454 LGERLYPRVHSLHPTFA 504 LGERL+P + ++HPT A Sbjct: 557 LGERLFPLIQAMHPTLA 573 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 61,209,900 Number of Sequences: 237096 Number of extensions: 1044813 Number of successful extensions: 2748 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 2379 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2748 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4706589866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -