BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0690 (623 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY819656-1|AAV70656.1| 56|Tribolium castaneum elongation facto... 57 1e-10 AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 22 3.6 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 22 3.6 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 22 3.6 DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 21 8.4 >AY819656-1|AAV70656.1| 56|Tribolium castaneum elongation factor 1-alpha protein. Length = 56 Score = 57.2 bits (132), Expect = 1e-10 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +3 Query: 165 QDVYKIGGIGTVPVGRVETGVLKPGTI 245 QDVYKIGGIGTVPVGRVETGVLKPG + Sbjct: 2 QDVYKIGGIGTVPVGRVETGVLKPGMV 28 Score = 49.2 bits (112), Expect = 3e-08 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = +2 Query: 257 PANXTTEVKSVEMHHEALQEAVPG 328 PAN TTEVKSVEMHHEAL EAVPG Sbjct: 33 PANITTEVKSVEMHHEALPEAVPG 56 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 22.2 bits (45), Expect = 3.6 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +2 Query: 527 FAENPRKS*PSYXVILLKSTXNSIKVWRCSH 619 + + PR S P + LL + I WR +H Sbjct: 119 YRDEPRFSQPHQILTLLMDIDSLITKWRYNH 149 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 22.2 bits (45), Expect = 3.6 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +2 Query: 527 FAENPRKS*PSYXVILLKSTXNSIKVWRCSH 619 + + PR S P + LL + I WR +H Sbjct: 279 YRDEPRFSQPHQILTLLMDIDSLITKWRYNH 309 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 22.2 bits (45), Expect = 3.6 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +2 Query: 527 FAENPRKS*PSYXVILLKSTXNSIKVWRCSH 619 + + PR S P + LL + I WR +H Sbjct: 279 YRDEPRFSQPHQILTLLMDIDSLITKWRYNH 309 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 21.0 bits (42), Expect = 8.4 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -2 Query: 316 FLESFVVHLHRLDFSSXVG 260 FLE + H R FSS VG Sbjct: 68 FLEMTLAHHCRFKFSSSVG 86 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,553 Number of Sequences: 336 Number of extensions: 3751 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15979473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -