BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0689 (562 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U64844-12|AAB18312.4| 417|Caenorhabditis elegans Hypothetical p... 27 7.0 AL110487-11|CAC42369.1| 624|Caenorhabditis elegans Hypothetical... 27 9.2 AL110487-10|CAC42368.1| 623|Caenorhabditis elegans Hypothetical... 27 9.2 AL110487-9|CAB54435.1| 626|Caenorhabditis elegans Hypothetical ... 27 9.2 >U64844-12|AAB18312.4| 417|Caenorhabditis elegans Hypothetical protein T22F3.10 protein. Length = 417 Score = 27.5 bits (58), Expect = 7.0 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +2 Query: 20 MQKLIIFALVVLCVGSEAKTFTRCGLVH 103 M L F L + C+G + F +CG++H Sbjct: 309 MLSLSFFILTMCCIGVNSGGFYKCGVLH 336 >AL110487-11|CAC42369.1| 624|Caenorhabditis elegans Hypothetical protein Y39E4B.12c protein. Length = 624 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = +2 Query: 119 GFEENLMRNWVCLVEHESSRDTSKTNTNRNGSKDYGLFQINDRYW 253 GF+ L NW + E + T + R+ + GLF I+ +Y+ Sbjct: 319 GFDWGLQFNWHSIPERDRKNRTRPIDPVRSPTMAGGLFSIDKKYF 363 >AL110487-10|CAC42368.1| 623|Caenorhabditis elegans Hypothetical protein Y39E4B.12b protein. Length = 623 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = +2 Query: 119 GFEENLMRNWVCLVEHESSRDTSKTNTNRNGSKDYGLFQINDRYW 253 GF+ L NW + E + T + R+ + GLF I+ +Y+ Sbjct: 319 GFDWGLQFNWHSIPERDRKNRTRPIDPVRSPTMAGGLFSIDKKYF 363 >AL110487-9|CAB54435.1| 626|Caenorhabditis elegans Hypothetical protein Y39E4B.12a protein. Length = 626 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = +2 Query: 119 GFEENLMRNWVCLVEHESSRDTSKTNTNRNGSKDYGLFQINDRYW 253 GF+ L NW + E + T + R+ + GLF I+ +Y+ Sbjct: 319 GFDWGLQFNWHSIPERDRKNRTRPIDPVRSPTMAGGLFSIDKKYF 363 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,950,633 Number of Sequences: 27780 Number of extensions: 229152 Number of successful extensions: 606 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 603 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 605 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1155524042 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -