BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0681 (709 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC637.07 |moe1||translation initiation factor eIF3d Moe1|Schiz... 115 8e-27 SPAC19E9.03 |pas1|SPAC57A10.01|cyclin Pas1|Schizosaccharomyces p... 27 2.6 SPBC30B4.01c |wsc1|SPBC3D6.14c|transmembrane receptor Wsc1 |Schi... 26 6.1 SPAC1805.01c |ppk6|SPAPJ736.02c|serine/threonine protein kinase ... 26 6.1 SPCC895.03c |||SUA5/yciO/yrdC family|Schizosaccharomyces pombe|c... 25 8.0 SPAC23A1.07 |||ubiquitin-protein ligase E3 |Schizosaccharomyces ... 25 8.0 SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pomb... 25 8.0 >SPAC637.07 |moe1||translation initiation factor eIF3d Moe1|Schizosaccharomyces pombe|chr 1|||Manual Length = 567 Score = 115 bits (276), Expect = 8e-27 Identities = 49/83 (59%), Positives = 64/83 (77%) Frame = +1 Query: 1 WRQKLDTQRGAVLANELRNNSCKLAKWTVQALLAGSDQIKFGYVSRAQVRDNSRHVILGT 180 WR KL++QRGAV A E++NNSCKLA+WTV+ALLAG D +K G+VSR+ RD H ILG Sbjct: 435 WRSKLESQRGAVFATEMKNNSCKLARWTVEALLAGVDSMKVGFVSRSNARDAQHHGILGV 494 Query: 181 QQFKPHEFAAQINLSMDNAWGIL 249 +KP + A+Q+NLS+ N WGI+ Sbjct: 495 VAYKPADLASQMNLSLSNGWGIV 517 Score = 60.9 bits (141), Expect = 2e-10 Identities = 22/38 (57%), Positives = 31/38 (81%) Frame = +3 Query: 255 IIDICMKQKDGKYLIMKDPNKPLIRLYDIPDNTFESDA 368 I D+C+K DGKY+++KDPN+P++RLY +P NTFE A Sbjct: 520 IADVCLKMPDGKYVLVKDPNRPILRLYSVPPNTFEEAA 557 >SPAC19E9.03 |pas1|SPAC57A10.01|cyclin Pas1|Schizosaccharomyces pombe|chr 1|||Manual Length = 411 Score = 27.1 bits (57), Expect = 2.6 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 5 DRSWTRSAAPCSPTSCGTTPASSPS 79 D S + AP +P S G+TP S+PS Sbjct: 227 DSSPILTMAPSTPVSVGSTPPSTPS 251 >SPBC30B4.01c |wsc1|SPBC3D6.14c|transmembrane receptor Wsc1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 374 Score = 25.8 bits (54), Expect = 6.1 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +2 Query: 11 SWTRSAAPCSPTSCGTTPASSPSGPCRHYXRARTRSSS 124 S T S++ SP+S TT +SPS + + SSS Sbjct: 134 STTSSSSSSSPSSSSTTTTTSPSSSSSSSSSSSSSSSS 171 >SPAC1805.01c |ppk6|SPAPJ736.02c|serine/threonine protein kinase Ppk6|Schizosaccharomyces pombe|chr 1|||Manual Length = 775 Score = 25.8 bits (54), Expect = 6.1 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +3 Query: 243 HPAVIIDICMKQKDGKYLIMKDPNKPLIRLYD 338 HP ++ I + + Y ++ +P KP I L+D Sbjct: 569 HPNIVKMITFFEDNENYYLLTEPQKPGIDLFD 600 >SPCC895.03c |||SUA5/yciO/yrdC family|Schizosaccharomyces pombe|chr 3|||Manual Length = 408 Score = 25.4 bits (53), Expect = 8.0 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 110 SEPASNACTVHLASLQELFRSSLASTAPRCVS 15 + PA N VH+ASL +L R L S P+ S Sbjct: 84 NRPADNPLIVHVASLDQL-RRLLLSAYPKAKS 114 >SPAC23A1.07 |||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 251 Score = 25.4 bits (53), Expect = 8.0 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = -3 Query: 164 WRELSRTCARDT*PNLIWSEPASNACTVHLASLQELFRSSLAS 36 W+ LS ++T N + S S L S QEL SSL S Sbjct: 104 WKGLSAMSGKNTFINGLQSYLISETALPELGSFQELSTSSLGS 146 >SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pombe|chr 2|||Manual Length = 2386 Score = 25.4 bits (53), Expect = 8.0 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -3 Query: 113 WSEPASNACTVHLASLQELFRSSLASTAPRCV 18 WS+ SN + SL+E +LAST+ RC+ Sbjct: 561 WSQHCSNFNKESMLSLREFIMKALASTS-RCL 591 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,244,177 Number of Sequences: 5004 Number of extensions: 38357 Number of successful extensions: 162 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 132 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 162 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 329179816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -