BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0676 (691 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X91509-1|CAA62809.1| 103|Apis mellifera histone H4 protein. 22 4.8 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 22 6.3 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 21 8.4 >X91509-1|CAA62809.1| 103|Apis mellifera histone H4 protein. Length = 103 Score = 22.2 bits (45), Expect = 4.8 Identities = 7/38 (18%), Positives = 22/38 (57%) Frame = +3 Query: 246 SRKIVLQQLRSILQEGIFNSNLRGSKTITNYDIIYTMR 359 +R ++ L +++++ + + KT+T D++Y ++ Sbjct: 55 TRGVLKVFLENVIRDAVTYTEHTKRKTVTAMDVVYALK 92 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -2 Query: 120 NSQEDFKITSNYYLY*FINYLGMY 49 N+Q+ + NYY + Y G Y Sbjct: 706 NAQQQVQAVRNYYANLYTKYHGQY 729 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/29 (37%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -1 Query: 289 SCRILLSCCKTIFLLKVPLQR*GS--GYL 209 SC ++L CK I++ + L G GYL Sbjct: 175 SCPLILGSCKCIYVQSINLCMAGRLFGYL 203 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,722 Number of Sequences: 438 Number of extensions: 3740 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -