BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0675 (675 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2F7.10 |||palmitoyltransferase |Schizosaccharomyces pombe|ch... 27 3.3 SPBC30B4.04c |sol1||SWI/SNF complex subunit Sol1|Schizosaccharom... 25 10.0 SPCP1E11.05c |||sterol O-acyltransferase |Schizosaccharomyces po... 25 10.0 >SPAC2F7.10 |||palmitoyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 642 Score = 26.6 bits (56), Expect = 3.3 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 3/34 (8%) Frame = -1 Query: 303 IF*FAWCHDIIIIYIRTVCMK---SLMLCLILFS 211 IF + WCH ++ I +T+ +K SL+ LI F+ Sbjct: 325 IFFWVWCHSLLYIVPKTLPIKPLSSLLFVLISFT 358 >SPBC30B4.04c |sol1||SWI/SNF complex subunit Sol1|Schizosaccharomyces pombe|chr 2|||Manual Length = 865 Score = 25.0 bits (52), Expect = 10.0 Identities = 18/79 (22%), Positives = 38/79 (48%), Gaps = 1/79 (1%) Frame = +2 Query: 5 YCMPGASCTHILNKILNV-THCPNTTIIIMIGRRGNADIRDIKYQINQLLTLQVKKIIMF 181 + P + C +++ +++V T C + ++ ++ +I D + QLL +I F Sbjct: 461 WMFPLSECQDVVDALIDVATQCLDN-LLSVLPNEDLMEIADKRPSYRQLLYNCCVEISQF 519 Query: 182 AFPFIQSMPAENKIRHSIN 238 + + +ENK + SIN Sbjct: 520 SREDFSNSLSENKTKDSIN 538 >SPCP1E11.05c |||sterol O-acyltransferase |Schizosaccharomyces pombe|chr 3|||Manual Length = 472 Score = 25.0 bits (52), Expect = 10.0 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = -3 Query: 223 YFIFCWHTLNKWKCKHDDL 167 ++ +C+H+LNK + K DL Sbjct: 190 WYSYCYHSLNKLQSKKTDL 208 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,612,497 Number of Sequences: 5004 Number of extensions: 50158 Number of successful extensions: 122 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 309878492 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -