BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0675 (675 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024878-2|AAK85512.1| 345|Caenorhabditis elegans Hypothetical ... 28 5.3 AC006638-9|AAK85480.1| 271|Caenorhabditis elegans Hypothetical ... 27 9.2 >AC024878-2|AAK85512.1| 345|Caenorhabditis elegans Hypothetical protein Y97E10AL.2 protein. Length = 345 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/50 (24%), Positives = 26/50 (52%) Frame = -1 Query: 606 YLWMGCVQINHVLLQEVNSVVLGFNLNYLERIPINKCHIFFLLKRSSRLI 457 + WM ++H++++ +NSV G + +RI + C I L +++ Sbjct: 236 FSWMNDFMVDHIIIRPLNSV--GLTMRSDKRIRLVSCPIIILHAEDDKIL 283 >AC006638-9|AAK85480.1| 271|Caenorhabditis elegans Hypothetical protein F41G4.1 protein. Length = 271 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +1 Query: 430 HIYLAMNLANQPTASFEQEKNMTF 501 +I+L +NLA + T+ E E N+TF Sbjct: 25 NIFLQVNLAEETTSKIEGETNVTF 48 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,397,362 Number of Sequences: 27780 Number of extensions: 278355 Number of successful extensions: 554 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 546 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 554 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1529108810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -