BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0672 (620 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 1.6 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 1.6 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 1.6 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 1.6 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 2.1 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 22 3.6 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.4 bits (48), Expect = 1.6 Identities = 12/35 (34%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +3 Query: 159 KERVYSIPSLQRRRWSLCSSKAVW-HNTGSLAQKS 260 K+ + +PS +R W C A W GSL + S Sbjct: 117 KQFIVKLPSAERVAWMWCLIFAFWVPQLGSLFRSS 151 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.4 bits (48), Expect = 1.6 Identities = 12/35 (34%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +3 Query: 159 KERVYSIPSLQRRRWSLCSSKAVW-HNTGSLAQKS 260 K+ + +PS +R W C A W GSL + S Sbjct: 117 KQFIVKLPSAERVAWMWCLIFAFWVPQLGSLFRSS 151 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.4 bits (48), Expect = 1.6 Identities = 12/35 (34%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +3 Query: 159 KERVYSIPSLQRRRWSLCSSKAVW-HNTGSLAQKS 260 K+ + +PS +R W C A W GSL + S Sbjct: 117 KQFIVKLPSAERVAWMWCLIFAFWVPQLGSLFRSS 151 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.4 bits (48), Expect = 1.6 Identities = 12/35 (34%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +3 Query: 159 KERVYSIPSLQRRRWSLCSSKAVW-HNTGSLAQKS 260 K+ + +PS +R W C A W GSL + S Sbjct: 117 KQFIVKLPSAERVAWMWCLIFAFWVPQLGSLFRSS 151 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.0 bits (47), Expect = 2.1 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 109 RKMPLRRAVRYLKNVIEKKECIPFR 183 R +PLR AV ++ ++I +P R Sbjct: 59 RALPLRSAVEHIPDLIADSRRLPLR 83 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 22.2 bits (45), Expect = 3.6 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 554 SSSSPFDAQAFSWKAFLRWGI 492 +S+S DAQ+ S + F RW + Sbjct: 350 ASNSSGDAQSTSLRPFSRWSL 370 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,244 Number of Sequences: 336 Number of extensions: 2979 Number of successful extensions: 12 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15875032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -