BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0672 (620 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 7.3 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 21 7.3 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 21 7.3 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 7.3 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.4 bits (43), Expect = 7.3 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 76 SEHGGLNHALCMISQGYP 23 +E GLNH M++ YP Sbjct: 223 TEDVGLNHFYFMLNHNYP 240 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 21.4 bits (43), Expect = 7.3 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -3 Query: 150 VFEVTNSTTERHLSXCH 100 V +T T ER+++ CH Sbjct: 142 VLTITAFTVERYIAICH 158 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.4 bits (43), Expect = 7.3 Identities = 16/58 (27%), Positives = 26/58 (44%), Gaps = 1/58 (1%) Frame = +3 Query: 186 LQRRRWSLCSSKAVWHNTGSLAQKSAEFLLQLLRNAESNADNK-TLDVDRLVIDHIQV 356 L RR S S + S A ++ EF+ + LRN + + +VID +Q+ Sbjct: 426 LADRRGSESSDSVLLSPEASKATEAVEFIAEHLRNEDLYIQTREDWKYVAMVIDRLQL 483 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.4 bits (43), Expect = 7.3 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 76 SEHGGLNHALCMISQGYP 23 +E GLNH M++ YP Sbjct: 223 TEDVGLNHFYFMLNHNYP 240 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,923 Number of Sequences: 438 Number of extensions: 3239 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18460203 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -