BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0668 (758 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 25 1.9 AF525673-3|AAM82612.1| 58|Anopheles gambiae cecropin CecC prot... 25 2.5 AY341429-1|AAR03495.1| 193|Anopheles gambiae sulfakinin preprop... 23 7.7 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 25.4 bits (53), Expect = 1.9 Identities = 13/48 (27%), Positives = 21/48 (43%) Frame = +3 Query: 447 QAP*PTSSRTGPPQTRRGRAAISPRARPQAGE*RHQQHPGXHQDLREQ 590 Q P + Q ++G + P+ R Q + +HQQ Q R+Q Sbjct: 277 QRPRQQQQQQQQQQQQQGERYVPPQLRQQRQQQQHQQQQQQQQQQRQQ 324 >AF525673-3|AAM82612.1| 58|Anopheles gambiae cecropin CecC protein. Length = 58 Score = 25.0 bits (52), Expect = 2.5 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +2 Query: 674 QGSTLKKMMDKHAGPRRVSSSTRKLLPI 757 +G KK + K RRV+++ +K LP+ Sbjct: 22 EGRRFKKFLKKEGAGRRVANAAQKGLPL 49 >AY341429-1|AAR03495.1| 193|Anopheles gambiae sulfakinin preproprotein protein. Length = 193 Score = 23.4 bits (48), Expect = 7.7 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 608 PGRLFVRGIPRRTVQGPTRPRRQGSTLKKMMD 703 PG + RRTVQGP +R +T + D Sbjct: 84 PGVIGAYEAYRRTVQGPQLMQRNPATADRFAD 115 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 722,139 Number of Sequences: 2352 Number of extensions: 13911 Number of successful extensions: 34 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -