BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0668 (758 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein pro... 22 7.2 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 9.5 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 9.5 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 9.5 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 9.5 >L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein protein. Length = 81 Score = 21.8 bits (44), Expect = 7.2 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +1 Query: 409 QAH*LPAHEGKADRLRNRPHHVQGPRKHVVGERPSALEH 525 + H LP + +RP +QG + GE+P + +H Sbjct: 37 RTHTLPCKCHLCGKAFSRPWLLQGHIRTHTGEKPFSCQH 75 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.4 bits (43), Expect = 9.5 Identities = 6/17 (35%), Positives = 10/17 (58%) Frame = -3 Query: 666 GRVGPCTVRRGIPRTNS 616 G+ GPC ++ +P S Sbjct: 616 GKAGPCAIKSVVPSDES 632 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.4 bits (43), Expect = 9.5 Identities = 6/17 (35%), Positives = 10/17 (58%) Frame = -3 Query: 666 GRVGPCTVRRGIPRTNS 616 G+ GPC ++ +P S Sbjct: 654 GKAGPCAIKSVVPSDES 670 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.4 bits (43), Expect = 9.5 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +1 Query: 19 YKSPSAPVCVKA*LIQLLLSRAHIFLSI 102 Y SP++ VC+ A LI L + +++ I Sbjct: 621 YISPASQVCIAAALIALQIVLTLVWMII 648 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.4 bits (43), Expect = 9.5 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +1 Query: 19 YKSPSAPVCVKA*LIQLLLSRAHIFLSI 102 Y SP++ VC+ A LI L + +++ I Sbjct: 711 YISPASQVCIAAALIALQIVLTLVWMII 738 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,392 Number of Sequences: 438 Number of extensions: 3781 Number of successful extensions: 17 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23875740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -