BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0663 (455 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U70858-9|AAB09181.2| 300|Caenorhabditis elegans Serpentine rece... 27 4.9 AF016420-3|AAB65310.1| 291|Caenorhabditis elegans Serpentine re... 27 4.9 AL031627-15|CAA20966.1| 318|Caenorhabditis elegans Hypothetical... 27 6.5 >U70858-9|AAB09181.2| 300|Caenorhabditis elegans Serpentine receptor, class x protein36 protein. Length = 300 Score = 27.5 bits (58), Expect = 4.9 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = -3 Query: 228 FWELLFI*LCILHVF*FSKICLDIKFHVHINNVLNLFC 115 F++ F+ L + HV IC D H H +N FC Sbjct: 66 FFDSSFMKLNVHHVAFILLICYDASIHAHAIITINRFC 103 >AF016420-3|AAB65310.1| 291|Caenorhabditis elegans Serpentine receptor, class sx protein13 protein. Length = 291 Score = 27.5 bits (58), Expect = 4.9 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -2 Query: 262 MYLNFYAYNVKILGIVIYIIMYFACILV 179 MY++FY Y+ G+++ IIM IL+ Sbjct: 80 MYISFYVYSQAAQGVLMLIIMLDLLILI 107 >AL031627-15|CAA20966.1| 318|Caenorhabditis elegans Hypothetical protein Y102A5C.25 protein. Length = 318 Score = 27.1 bits (57), Expect = 6.5 Identities = 11/35 (31%), Positives = 23/35 (65%), Gaps = 2/35 (5%) Frame = -2 Query: 274 ASQIMYLNFYAY--NVKILGIVIYIIMYFACILVF 176 A I +N+Y+ N ++ I +Y +++FACI+++ Sbjct: 3 AHDIQRINYYSNLKNFDLILIGLYGLLFFACIIIY 37 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,814,827 Number of Sequences: 27780 Number of extensions: 127945 Number of successful extensions: 281 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 279 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 281 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 809909048 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -