BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0650 (430 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 3.5 AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. 22 8.0 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.4 bits (48), Expect = 3.5 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +3 Query: 324 RRETTEDCVCGLIFTTN 374 R T D +CGLIF N Sbjct: 533 RSNDTTDALCGLIFCNN 549 >AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. Length = 438 Score = 22.2 bits (45), Expect = 8.0 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 254 PSPSKDNISLNVPLDWNRDQLRDPARNH*GL 346 P P+ + + NV R ++ DP R+H GL Sbjct: 350 PHPTLEEMQDNVVTKKLRPRIFDPWRHHPGL 380 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 369,221 Number of Sequences: 2352 Number of extensions: 7198 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 35292513 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -