BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0636 (626 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0629 + 12386214-12386533,12386666-12386749,12386834-123869... 29 3.0 12_02_0522 - 19960092-19960595,19962737-19962880,19963042-199631... 27 9.2 >02_02_0629 + 12386214-12386533,12386666-12386749,12386834-12386972, 12387990-12388061,12388158-12388252,12388397-12388483, 12388554-12388629,12388738-12389031,12389526-12389665, 12389751-12389939,12390028-12390118,12390206-12390332, 12391146-12391253,12391343-12391433,12391676-12391685 Length = 640 Score = 29.1 bits (62), Expect = 3.0 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 3/50 (6%) Frame = +2 Query: 344 YMHKCSL*Y---NDIDSAFYSVWCRLICKYLSSINICRSLQIQQPTDRLI 484 Y H+C L ND + W C+ + + + CR + QQPT RL+ Sbjct: 229 YCHRCLLKRYDENDEEVGQMEAWICPKCRGICNCSCCRRKKGQQPTGRLV 278 >12_02_0522 - 19960092-19960595,19962737-19962880,19963042-19963131, 19963215-19963320,19963400-19963574,19963849-19963951, 19964382-19964636,19964726-19964803,19964908-19965000, 19965091-19965222,19965898-19966002,19966127-19966201, 19966284-19966340,19966419-19966532,19966613-19966756, 19966886-19966969,19967071-19967164,19967244-19967369, 19967507-19967580,19967672-19967875,19968234-19968388, 19968860-19968947,19969505-19969730,19970235-19970286, 19970766-19970958,19973221-19973314,19973744-19973788, 19974874-19974896 Length = 1210 Score = 27.5 bits (58), Expect = 9.2 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = +1 Query: 76 DETKTS--SRTKYVIKKSTDWS-HSERQSLW 159 DETKT +TK V++K DW +E Q +W Sbjct: 586 DETKTEVKKKTKTVVEKYWDWELTNETQPIW 616 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,500,915 Number of Sequences: 37544 Number of extensions: 298885 Number of successful extensions: 594 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 594 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1525730988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -