BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0634 (447 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 24 0.57 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 22 2.3 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 24.2 bits (50), Expect = 0.57 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -3 Query: 193 CY*KYDRHPFNFIYQKVNSIKREQMYVNEK 104 C Y+ F F+ + SIKR + +NEK Sbjct: 569 CDLMYEFQIFTFLMSLLQSIKRRYVLLNEK 598 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 22.2 bits (45), Expect = 2.3 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -3 Query: 184 KYDRHPFNFIYQKVNSIKREQMYVNEKKY 98 K+DRH +F N++ E+ NE K+ Sbjct: 88 KHDRHERHFESSFGNNLHSEKAKFNESKW 116 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,704 Number of Sequences: 336 Number of extensions: 1792 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10090848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -