BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0634 (447 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 26 0.70 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 3.7 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 23 4.9 DQ182016-1|ABA56308.1| 353|Anopheles gambiae G(alpha)i protein. 23 6.5 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 6.5 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 25.8 bits (54), Expect = 0.70 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 3/45 (6%) Frame = -3 Query: 268 CXLCNTVRPKSMSSG---RHCEYGGKCQCY*KYDRHPFNFIYQKV 143 C CN + +S+ R C G CQC YDR +F Q+V Sbjct: 219 CGTCNQITCSGISTEVCRRSCYCG--CQCRRGYDRDVLHFDEQRV 261 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.4 bits (48), Expect = 3.7 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 340 HHRLHHAHFATENDPF 387 HH HH H ND F Sbjct: 656 HHHHHHHHHQNPNDHF 671 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 23.0 bits (47), Expect = 4.9 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 170 MTVIFLITLTFPAILAMTTGAHRLWAHRITKXAQ 271 +T+IF +L ++ A+R H++TK Q Sbjct: 562 LTIIFCSVYRILGVLILSALANRFRIHKLTKVDQ 595 >DQ182016-1|ABA56308.1| 353|Anopheles gambiae G(alpha)i protein. Length = 353 Score = 22.6 bits (46), Expect = 6.5 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -1 Query: 216 ASMAGNVNVIKNMTVIHLTSY 154 A +G ++K M +IH T Y Sbjct: 40 AGESGKSTIVKQMKIIHETGY 60 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 22.6 bits (46), Expect = 6.5 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +1 Query: 325 YNXVRHHRLHHAHFAT 372 YN +HH+ HH T Sbjct: 1279 YNTTQHHQTHHERRTT 1294 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 436,302 Number of Sequences: 2352 Number of extensions: 6660 Number of successful extensions: 19 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 37843779 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -