BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0630 (681 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0232 + 6614784-6614882,6616145-6616477,6616708-6616967,661... 38 0.006 03_02_0331 - 7527010-7529352 30 2.0 10_08_0327 + 16797366-16800639,16800979-16801067,16801120-16801593 29 2.6 06_02_0248 + 13468100-13468336,13468426-13468569,13469044-134698... 29 3.4 12_01_0527 - 4177928-4178235,4178849-4181438 28 6.0 02_03_0204 - 16369800-16371758,16372260-16372331 28 6.0 >03_02_0232 + 6614784-6614882,6616145-6616477,6616708-6616967, 6617328-6617469,6617567-6617938,6618056-6618187, 6618907-6619035,6619125-6621188 Length = 1176 Score = 38.3 bits (85), Expect = 0.006 Identities = 23/102 (22%), Positives = 42/102 (41%) Frame = +1 Query: 184 DVCGGSDSGLCRTHDAQVLTGCNNTMQHHKHFCLEVSDNCSPTIDHCIIRSASVVGAAVC 363 D+C C ++ T C T+ K C D S + ++ S S G + C Sbjct: 822 DICKSETDQPCENNEKNQATSCGGTIMVDKQDCYSTKDEGSGHDEELMMNSTSSDGLSSC 881 Query: 364 VTVPARIP*SSTVTLVTARTLVSMSQTTRKALITIMKSQETP 489 + R +S+VT ++A+ S S + ++ + +E P Sbjct: 882 TSEADRESSTSSVTSLSAQHQESSSSDSEESPERVNSIEEAP 923 >03_02_0331 - 7527010-7529352 Length = 780 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/58 (29%), Positives = 32/58 (55%), Gaps = 3/58 (5%) Frame = +1 Query: 325 IIRSASVVGAAVCVTVPARIP*SS---TVTLVTARTLVSMSQTTRKALITIMKSQETP 489 +IR+A+ VGAA T R+ +S +VT+ + + S + T++ +T+ S +P Sbjct: 691 VIRTATNVGAAASATYKPRVEMASSAVSVTIKPEKLVFSPTAKTQRFAVTVASSSSSP 748 >10_08_0327 + 16797366-16800639,16800979-16801067,16801120-16801593 Length = 1278 Score = 29.5 bits (63), Expect = 2.6 Identities = 22/72 (30%), Positives = 31/72 (43%), Gaps = 3/72 (4%) Frame = +2 Query: 188 FAEGATRAYAGHMTLKFSPDATIPCSIIST--SVSRSQITVHPQLITVLSGALVLWVQQC 361 F + AY G+ L PC I ST S + V +++V+ L+L V C Sbjct: 812 FQNASASAYVGNSGLCGDVQGLTPCDISSTGSSSGHHKRVVIATVVSVVGVVLLLAVVTC 871 Query: 362 -ALRCRRESRNQ 394 L CRR R + Sbjct: 872 IILLCRRRPREK 883 >06_02_0248 + 13468100-13468336,13468426-13468569,13469044-13469808, 13470272-13470564,13470642-13470833,13471151-13471229, 13471339-13471431,13471519-13471704 Length = 662 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 6/49 (12%) Frame = +3 Query: 528 CVVTIYITDVTSVYLRSRMD------WVTLKPTIFTTIESPVSKLRPAR 656 C++ +Y +D+ S+Y R R+D W + ++ PV+ L P R Sbjct: 452 CLLQVYFSDMHSLYHRKRLDANLIAIWCLMNYVEAEAMKKPVAYLNPCR 500 >12_01_0527 - 4177928-4178235,4178849-4181438 Length = 965 Score = 28.3 bits (60), Expect = 6.0 Identities = 16/39 (41%), Positives = 24/39 (61%) Frame = +2 Query: 224 MTLKFSPDATIPCSIISTSVSRSQITVHPQLITVLSGAL 340 ++L SPD I+ T VSR+ VH Q+++VL+ AL Sbjct: 905 LSLSGSPDQRE--QILDTRVSRTSAAVHSQMLSVLNIAL 941 >02_03_0204 - 16369800-16371758,16372260-16372331 Length = 676 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +1 Query: 214 CRTHDAQVLTGCNNTMQHHKHFCLEVSDNCSPTIDHCII 330 CR H+ + +M+ + F LEVS N T+ H I Sbjct: 181 CRVHNLMHKISVSKSMEENHGFVLEVSSNNEGTVRHLSI 219 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,344,704 Number of Sequences: 37544 Number of extensions: 372896 Number of successful extensions: 1109 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1079 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1109 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1721314888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -