BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0630 (681 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 29 0.054 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 8.2 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 28.7 bits (61), Expect = 0.054 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -3 Query: 661 GVRAGLNFETGDSIVVNIVGFKVTQSI 581 GV G+NF+ D+I VN+ G V Q I Sbjct: 169 GVEIGINFDKYDNIQVNVSGDNVPQPI 195 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.4 bits (43), Expect = 8.2 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 7/64 (10%) Frame = +1 Query: 316 DHCIIRSASVVGAAVCVTV--PARIP*SSTVTLVTARTLVSMSQ-----TTRKALITIMK 474 DHC+ SVV V T+ P S + T V +L + S T K +I +K Sbjct: 821 DHCVTTEQSVVVTNVTTTINTPTTSVISMSGTTVPITSLPASSTSINSITVEKDVINDVK 880 Query: 475 SQET 486 +Q T Sbjct: 881 TQIT 884 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,924 Number of Sequences: 438 Number of extensions: 3514 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20708550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -