BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0629 (631 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 22 4.9 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 4.9 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 21 6.4 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 6.4 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.8 bits (44), Expect = 4.9 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -3 Query: 116 TRYLSFFMCSYSFLNWRIWKVL 51 T LSFF+C F + +W +L Sbjct: 294 TVVLSFFLCLIPFRVFILWIIL 315 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.8 bits (44), Expect = 4.9 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +2 Query: 476 FTVFTSFSNLLSELF*YNENFIVTLTAN-GRRRRVAENRYFDLKV 607 F+ SN + + Y E+ + ++T + GRRR+ E R L V Sbjct: 557 FSSLKELSNHMVKNSHYKEHIMRSITESGGRRRQTREKRKKSLPV 601 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 21.4 bits (43), Expect = 6.4 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = +1 Query: 73 FRKLYEHIKNDKYLVGQRLVNY 138 + Y+H+ + L +R+VNY Sbjct: 21 YESRYDHLDVESILNNRRMVNY 42 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.4 bits (43), Expect = 6.4 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -3 Query: 383 ISSIIFYLFVSFTKSNLFIYRS*WERRKVREKFRLQ 276 + SI + F++ K IY+ +R K REK ++ Sbjct: 532 LKSIAWRAFLAVLKRRTEIYKGLIDRIKSREKLTMK 567 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,981 Number of Sequences: 336 Number of extensions: 2302 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16188355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -