BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0629 (631 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC649.03 |rhp14||XP-A family homolog Rhp14|Schizosaccharomyces... 28 0.97 SPBC30B4.04c |sol1||SWI/SNF complex subunit Sol1|Schizosaccharom... 25 6.8 SPBC1921.05 |ape2||aminopeptidase Ape2|Schizosaccharomyces pombe... 25 9.0 SPAPB24D3.09c |pdr1||ABC transporter Pdr1|Schizosaccharomyces po... 25 9.0 >SPBC649.03 |rhp14||XP-A family homolog Rhp14|Schizosaccharomyces pombe|chr 2|||Manual Length = 289 Score = 28.3 bits (60), Expect = 0.97 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +3 Query: 48 LEDLPDPPIQKTIRTHKERQVPGRSAARELRSPETEAAAQQCRHVD 185 +EDL + P ++ +R +ERQ R A L PET +C ++ Sbjct: 79 VEDLREKPAERELREQEERQKKLRLAPLNL-DPETAPKCFECDSIE 123 >SPBC30B4.04c |sol1||SWI/SNF complex subunit Sol1|Schizosaccharomyces pombe|chr 2|||Manual Length = 865 Score = 25.4 bits (53), Expect = 6.8 Identities = 15/47 (31%), Positives = 21/47 (44%) Frame = +3 Query: 99 ERQVPGRSAARELRSPETEAAAQQCRHVDKLKPVRSVPLKIYIDLIL 239 ER P +A +P T + VD +PV P+K ID +L Sbjct: 352 ERNAPPYPSAPTRPTPPTVQTSSSAAPVDSAEPVAYQPIKKPIDPML 398 >SPBC1921.05 |ape2||aminopeptidase Ape2|Schizosaccharomyces pombe|chr 2|||Manual Length = 882 Score = 25.0 bits (52), Expect = 9.0 Identities = 5/18 (27%), Positives = 14/18 (77%) Frame = -3 Query: 110 YLSFFMCSYSFLNWRIWK 57 ++S+F C++ + W++W+ Sbjct: 344 WMSWFSCNHFYPEWKVWE 361 >SPAPB24D3.09c |pdr1||ABC transporter Pdr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1396 Score = 25.0 bits (52), Expect = 9.0 Identities = 14/60 (23%), Positives = 28/60 (46%) Frame = -2 Query: 495 NEVKTVKFMLIINTN*IVYRYF*NCFSLYRSMWEQIKYQFNYFLSFCFLY*KQPFYLSFL 316 ++ + KF+ +N+N + Y F+ + + Q + ++Y +F F Y Q L L Sbjct: 390 DQTRLQKFLRWLNSNPCLIPYRLQVFATAKVTFFQYLHDYSYIATFVFTYVFQALMLGSL 449 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,221,664 Number of Sequences: 5004 Number of extensions: 42648 Number of successful extensions: 112 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 279695522 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -