BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0629 (631 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT015257-1|AAT94486.1| 988|Drosophila melanogaster LP04173p pro... 56 3e-08 AY058479-1|AAL13708.1| 700|Drosophila melanogaster GH28722p pro... 56 3e-08 AE014296-443|AAF47637.2| 988|Drosophila melanogaster CG1317-PB ... 56 3e-08 BT028798-1|ABI34179.1| 1567|Drosophila melanogaster LD03710p pro... 30 2.2 AY052006-1|AAK93430.1| 1561|Drosophila melanogaster LD46954p pro... 30 2.2 AE013599-2155|AAF58081.2| 1567|Drosophila melanogaster CG8370-PA... 30 2.2 AE013599-1331|AAF58632.2| 857|Drosophila melanogaster CG30035-P... 28 9.1 >BT015257-1|AAT94486.1| 988|Drosophila melanogaster LP04173p protein. Length = 988 Score = 56.4 bits (130), Expect = 3e-08 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +1 Query: 58 FQIRQFRKLYEHIKNDKYLVGQRLVNYDHRRQKQQ 162 FQI Q +KLY IK DKYLVGQRLVNY+HR+++QQ Sbjct: 914 FQIDQLKKLYLSIKVDKYLVGQRLVNYEHRKKQQQ 948 >AY058479-1|AAL13708.1| 700|Drosophila melanogaster GH28722p protein. Length = 700 Score = 56.4 bits (130), Expect = 3e-08 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +1 Query: 58 FQIRQFRKLYEHIKNDKYLVGQRLVNYDHRRQKQQ 162 FQI Q +KLY IK DKYLVGQRLVNY+HR+++QQ Sbjct: 626 FQIDQLKKLYLSIKVDKYLVGQRLVNYEHRKKQQQ 660 >AE014296-443|AAF47637.2| 988|Drosophila melanogaster CG1317-PB protein. Length = 988 Score = 56.4 bits (130), Expect = 3e-08 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +1 Query: 58 FQIRQFRKLYEHIKNDKYLVGQRLVNYDHRRQKQQ 162 FQI Q +KLY IK DKYLVGQRLVNY+HR+++QQ Sbjct: 914 FQIDQLKKLYLSIKVDKYLVGQRLVNYEHRKKQQQ 948 >BT028798-1|ABI34179.1| 1567|Drosophila melanogaster LD03710p protein. Length = 1567 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -3 Query: 365 YLFVSFTKSNLFIYRS*W-ERRKVREKFRLQNRRENAA 255 Y + +SNL +Y + W + R V+ +FR NRR AA Sbjct: 881 YCTLLHVRSNLTLYEAVWLQARAVQSQFRFGNRRPGAA 918 >AY052006-1|AAK93430.1| 1561|Drosophila melanogaster LD46954p protein. Length = 1561 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -3 Query: 365 YLFVSFTKSNLFIYRS*W-ERRKVREKFRLQNRRENAA 255 Y + +SNL +Y + W + R V+ +FR NRR AA Sbjct: 875 YCTLLHVRSNLTLYEAVWLQARAVQSQFRFGNRRPGAA 912 >AE013599-2155|AAF58081.2| 1567|Drosophila melanogaster CG8370-PA protein. Length = 1567 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -3 Query: 365 YLFVSFTKSNLFIYRS*W-ERRKVREKFRLQNRRENAA 255 Y + +SNL +Y + W + R V+ +FR NRR AA Sbjct: 881 YCTLLHVRSNLTLYEAVWLQARAVQSQFRFGNRRPGAA 918 >AE013599-1331|AAF58632.2| 857|Drosophila melanogaster CG30035-PA, isoform A protein. Length = 857 Score = 28.3 bits (60), Expect = 9.1 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +3 Query: 39 SASLEDLPDPPIQKTIRTHKERQVPGRSAARELRSPET 152 S L LP PP IR H++RQ G RS ++ Sbjct: 120 SLELTPLPPPPTSLEIREHRDRQQRGAQGDELQRSKQS 157 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,014,416 Number of Sequences: 53049 Number of extensions: 414806 Number of successful extensions: 1058 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1030 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1058 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2621070450 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -