BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0629 (631 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g49290.1 68416.m05387 expressed protein 33 0.21 At4g34100.1 68417.m04838 zinc finger (C3HC4-type RING finger) fa... 31 0.48 At5g24310.1 68418.m02861 expressed protein strong similarity to ... 31 0.83 At1g05600.1 68414.m00580 pentatricopeptide (PPR) repeat-containi... 29 1.9 At1g71050.1 68414.m08200 heavy-metal-associated domain-containin... 28 5.9 >At3g49290.1 68416.m05387 expressed protein Length = 312 Score = 32.7 bits (71), Expect = 0.21 Identities = 33/110 (30%), Positives = 53/110 (48%), Gaps = 3/110 (2%) Frame = +3 Query: 42 ASLEDLPDPPIQK-TIRTHKERQVPGRSAARELRSPETEAAAQQCRHVDKLKPVRSVPLK 218 A++ + P PP++K T ++ RQ P RSA S T +Q + + P R PL Sbjct: 172 ATIRETPPPPVRKSTSQSSSPRQPPQRSATFSFTS--TIPKKEQDKR--SVSPHR-FPLL 226 Query: 219 IYIDLILRASV*SGVFSTILKSKLLS--YFPPFPLRTINKKVAFSKGNKK 362 + R S +T KS+ ++ +P P R+ + +VAF K N+K Sbjct: 227 RSGSVATRKSASISRPTTPSKSRSITPIRYPSEPRRSASVRVAFEKDNQK 276 >At4g34100.1 68417.m04838 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 1092 Score = 31.5 bits (68), Expect = 0.48 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +1 Query: 73 FRKLYEHIKNDKYLVGQRLVNYDHRRQKQQHSS 171 FR L+ I++D+YL+G+RL N+ Q+ + Sbjct: 1028 FRNLHNSIRDDRYLIGRRLHNFGEAALANQNQN 1060 >At5g24310.1 68418.m02861 expressed protein strong similarity to unknown protein (emb|CAB66408.1) Length = 321 Score = 30.7 bits (66), Expect = 0.83 Identities = 31/111 (27%), Positives = 52/111 (46%), Gaps = 4/111 (3%) Frame = +3 Query: 42 ASLEDLPDPPIQKTIRTHKERQVPGRSAARELRSPETEAAAQQCRHVDKLKPVRSVPLKI 221 A++ + P PP++K I ++ P RSA S T +Q + + P R PL Sbjct: 178 ATIRETPPPPVRKPILQSPSQRKPQRSATFSFSSIATAPKKEQDKRA--VSPHR-FPLLR 234 Query: 222 YIDLILRASV*SGVFSTILKSKLLS----YFPPFPLRTINKKVAFSKGNKK 362 + +R S S +T KS+ ++ +P P R+ + +VAF K +K Sbjct: 235 SGSVAIRPSSISRP-TTPSKSRAVTPTPKRYPSEPRRSASVRVAFEKEAQK 284 >At1g05600.1 68414.m00580 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile: PF01535 PPR repeat Length = 504 Score = 29.5 bits (63), Expect = 1.9 Identities = 15/46 (32%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +2 Query: 179 RRQTEACSLRASKNLYRSHSKGLCLERRFLDDSEV-ETSLVLSSFP 313 ++ ++ S A++ Y++ GLC + +FL+ S+V E L+ S FP Sbjct: 393 KKMSKQVSCVANEETYQTLVDGLCRDGQFLEASQVMEEMLIKSHFP 438 >At1g71050.1 68414.m08200 heavy-metal-associated domain-containing protein / copper chaperone (CCH)-related low similarity to copper homeostasis factor [GI:3168840][PMID:9701579]; similar to farnesylated protein ATFP7 [GI:4097555]; contains heavy-metal-associated domain PF00403 Length = 152 Score = 27.9 bits (59), Expect = 5.9 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = -2 Query: 588 RFSATRRRRPLAVKVTIKFSLY*NSSERRLENEVKTVKFMLIINTN 451 R + RR+R + V IK + + ERR++N V ++K + + N Sbjct: 16 RVTRKRRKRKVMQTVNIKVKMDCDGCERRVKNAVSSMKGVKSVEVN 61 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,202,155 Number of Sequences: 28952 Number of extensions: 201142 Number of successful extensions: 516 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 506 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 514 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1285411824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -