BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0627 (556 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein... 30 0.059 AY428512-1|AAR89530.1| 420|Anopheles gambiae EKN1 protein. 30 0.059 DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. 23 6.7 >CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein protein. Length = 420 Score = 29.9 bits (64), Expect = 0.059 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +3 Query: 384 FSEQKYDEAINLYTAAIQFNPQSALLFAKRGTGVSKN*PTQ*CIKDCTHALEL 542 F ++ + AI+ Y+A I+ LF R Q C +DC+ ALEL Sbjct: 294 FQQRNFLAAISAYSAGIRLTKDYYALFLNRSAAHLALENYQRCAEDCSTALEL 346 >AY428512-1|AAR89530.1| 420|Anopheles gambiae EKN1 protein. Length = 420 Score = 29.9 bits (64), Expect = 0.059 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +3 Query: 384 FSEQKYDEAINLYTAAIQFNPQSALLFAKRGTGVSKN*PTQ*CIKDCTHALEL 542 F ++ + AI+ Y+A I+ LF R Q C +DC+ ALEL Sbjct: 294 FQQRNFLAAISAYSAGIRLTKDYYALFLNRSAAHLALENYQRCAEDCSTALEL 346 >DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. Length = 847 Score = 23.0 bits (47), Expect = 6.7 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +1 Query: 475 GQVYPKTDQPNDVLKTAHMP 534 G+VY + + ND+L H+P Sbjct: 341 GKVYDRCELANDLLHKFHLP 360 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 549,409 Number of Sequences: 2352 Number of extensions: 10846 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 51722361 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -