BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0623 (747 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 24 1.5 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 2.6 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 22 4.5 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 22 4.5 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 23.8 bits (49), Expect = 1.5 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -1 Query: 258 MYR*INKIFGTH*SKTSLVILILLIVENYH 169 M + INK++G T L LI I E YH Sbjct: 224 MCKKINKLYGHQLLLTILTYLIWTIYEMYH 253 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -3 Query: 667 YSGLQLFHLKTKTTVAQGRPYPSRKAGYLP 578 Y L+ LK+ + RP+P R G P Sbjct: 313 YCAFSLYPLKSTFYLNVVRPFPERSMGITP 342 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +3 Query: 249 IYTFEIERIYEFL*FC 296 +Y EIE+ Y L FC Sbjct: 321 VYHLEIEKYYNILYFC 336 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 134 RFCTTDTSWR 105 R CT DTSWR Sbjct: 251 RNCTGDTSWR 260 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,699 Number of Sequences: 336 Number of extensions: 3731 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19923648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -