BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0623 (747 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 23 4.0 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 22 7.0 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 21 9.3 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 22.6 bits (46), Expect = 4.0 Identities = 8/30 (26%), Positives = 17/30 (56%) Frame = -3 Query: 235 IWNSLIKNIFGNLNSFDCRKLSLTCSLLQN 146 +WNS + +I G + + CR+ L+++ Sbjct: 472 VWNSWMPSIRGAIQQWTCRQPEPLIELIEH 501 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 21.8 bits (44), Expect = 7.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -3 Query: 397 WYH*LCIRNVYLYIRYIFFKTNI 329 W LCI VY+ + IF NI Sbjct: 399 WSAFLCISLVYIIMLIIFIPRNI 421 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 21.4 bits (43), Expect = 9.3 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = +2 Query: 563 YRVSSGKVARFPRRIRSSLRD--GGLSF*MKKLQTTVFSKITSKIPGVTTNK 712 YR V +R+ S D G L+F L TTV + + K+P + N+ Sbjct: 242 YRRLVHAVNEIEKRLLFSHNDRLGFLTFCPTNLGTTVRASVHIKLPKLAANR 293 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,477 Number of Sequences: 438 Number of extensions: 4384 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23388480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -