BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0606 (756 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52029| Best HMM Match : RRM_1 (HMM E-Value=1e-18) 52 4e-07 SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) 47 1e-05 SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) 42 7e-04 SB_39475| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) 41 0.001 SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) 40 0.002 SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28) 38 0.007 SB_1040| Best HMM Match : RRM_1 (HMM E-Value=1e-05) 38 0.007 SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) 36 0.036 SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38) 35 0.062 SB_35697| Best HMM Match : RRM_1 (HMM E-Value=1.3e-19) 35 0.082 SB_30745| Best HMM Match : UIM (HMM E-Value=1.9) 34 0.14 SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) 33 0.19 SB_28139| Best HMM Match : RRM_1 (HMM E-Value=3.7e-28) 33 0.19 SB_28089| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18) 33 0.25 SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0) 32 0.44 SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.44 SB_47831| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.58 SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) 31 0.76 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 31 0.76 SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35) 30 2.3 SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) 30 2.3 SB_11300| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_41149| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_44114| Best HMM Match : RRM_1 (HMM E-Value=9.9e-35) 29 5.4 SB_37378| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_56343| Best HMM Match : RRM_1 (HMM E-Value=3.2e-14) 28 7.1 SB_37749| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_56337| Best HMM Match : RVT_1 (HMM E-Value=1.7e-23) 28 7.1 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.4 SB_28695| Best HMM Match : Ras (HMM E-Value=0) 28 9.4 >SB_52029| Best HMM Match : RRM_1 (HMM E-Value=1e-18) Length = 462 Score = 52.4 bits (120), Expect = 4e-07 Identities = 22/53 (41%), Positives = 33/53 (62%) Frame = +2 Query: 101 DRSSDXHRTESRRLFVSNIPYEFRWTELKDLFKEKVGDVAYVELLTDDSGKEE 259 +R S +++FVSNIP+E RW LKD + VGDVA+ E+ D+ G+ + Sbjct: 82 NRRSRSSGAPEKKVFVSNIPFESRWQNLKDHMNKVVGDVAFAEIFEDEKGRSK 134 Score = 50.0 bits (114), Expect = 2e-06 Identities = 20/56 (35%), Positives = 33/56 (58%) Frame = +3 Query: 528 PLVKKVFVANLDYKADQAKIKEVFKMAGKVRNIDLAVDKDGNSRGFAVIEYDHPLK 695 P VFV NLDYK + K+K+ FK AG V ++ D + S+G ++++ P++ Sbjct: 182 PAASTVFVTNLDYKVNWQKLKDTFKCAGHVIRAEIMEDDEKKSKGMGTVQFETPME 237 >SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) Length = 1313 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/55 (38%), Positives = 35/55 (63%), Gaps = 1/55 (1%) Frame = +3 Query: 528 PLVKKVFVANLDYKADQAKIKEVFKMAGKVRNIDLAVDKDGN-SRGFAVIEYDHP 689 P K++VA+L ++ ++E+F + G+V+ +DL D+ N SRGFA +EY P Sbjct: 1154 PKPTKLYVAHLTRNVNKDHVQEIFSVYGRVKTVDLPTDRTNNLSRGFAYVEYVDP 1208 >SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 718 Score = 41.5 bits (93), Expect = 7e-04 Identities = 17/59 (28%), Positives = 31/59 (52%) Frame = +3 Query: 513 INVQPPLVKKVFVANLDYKADQAKIKEVFKMAGKVRNIDLAVDKDGNSRGFAVIEYDHP 689 + QP V+V N D ++KE+ AGK+ ++ + D +G S+GF + ++ P Sbjct: 101 MGTQPKKFTNVYVKNFGDDMDDEQMKEICAEAGKIVSLKVMTDPEGKSKGFGFVSFETP 159 Score = 35.5 bits (78), Expect = 0.047 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = +3 Query: 543 VFVANLDYKADQAKIKEVFKMAGKVRNIDLAVDKDGNSRGFAVIEYDHP 689 +++ NLD D +++E F G + + + D GNS+GF + + P Sbjct: 214 LYIKNLDDPIDDERLREEFSPYGTISSAKVMKDDKGNSKGFGFVCFSSP 262 >SB_39475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 333 Score = 41.1 bits (92), Expect = 0.001 Identities = 15/47 (31%), Positives = 31/47 (65%) Frame = +3 Query: 543 VFVANLDYKADQAKIKEVFKMAGKVRNIDLAVDKDGNSRGFAVIEYD 683 +FV+NL + A +++I+E+F G V+ + L ++ G +G+ +EY+ Sbjct: 173 LFVSNLPFDAKESEIEELFSKHGVVKQVRLVTNRAGKPKGYGYVEYE 219 Score = 35.5 bits (78), Expect = 0.047 Identities = 17/42 (40%), Positives = 29/42 (69%) Frame = +2 Query: 128 ESRRLFVSNIPYEFRWTELKDLFKEKVGDVAYVELLTDDSGK 253 + LFVSN+P++ + +E+++LF K G V V L+T+ +GK Sbjct: 169 DKHTLFVSNLPFDAKESEIEELF-SKHGVVKQVRLVTNRAGK 209 >SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) Length = 328 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 1/52 (1%) Frame = +3 Query: 534 VKKVFVANLDYKADQAKIKEVFKMAGKVRNIDLAVDK-DGNSRGFAVIEYDH 686 + K+FV L Y+ + +KE F G++ +D+ +D G RGFA +++ H Sbjct: 28 IGKLFVGGLSYETTKESLKEYFSKYGELVGVDIKMDALTGRPRGFAFVQFKH 79 Score = 32.7 bits (71), Expect = 0.33 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +3 Query: 534 VKKVFVANLDYKADQAKIKEVF-KMAGKVRNIDLAVDKDGN-SRGFAVIEYD 683 VKK+FV L + KI+E F K V+ I+ + N RGF + +D Sbjct: 102 VKKIFVGGLKPETSDEKIREYFGKAYAPVKEIEYITEHSSNRRRGFCFVSFD 153 >SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) Length = 392 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Frame = +3 Query: 534 VKKVFVANLDYKADQAKIKEVFKMAGKVRNIDLAVDKD-GNSRGFAVIEY 680 ++ VFV N+ Y+A + ++KE+F G V + L D++ G +G+ EY Sbjct: 24 LRSVFVGNIPYEASEEQLKEIFSEVGPVISFRLVFDRETGKPKGYGFCEY 73 Score = 35.1 bits (77), Expect = 0.062 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Frame = +2 Query: 92 ANRDRSSDXHRTESRRLFVSNIPYEFRWTELKDLFKEKVGDVAYVELLTD-DSGK 253 A + +SS R +FV NIPYE +LK++F E VG V L+ D ++GK Sbjct: 11 AQQKQSSGAADRSLRSVFVGNIPYEASEEQLKEIFSE-VGPVISFRLVFDRETGK 64 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +1 Query: 229 IVDR*QWKRRGCGIVEFTNTEAMKKALFVMHRYELNGRKL 348 + DR K +G G E+ + E A+ ++ YELNGR L Sbjct: 57 VFDRETGKPKGYGFCEYKDQETALSAMRNLNGYELNGRAL 96 >SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28) Length = 440 Score = 38.3 bits (85), Expect = 0.007 Identities = 22/72 (30%), Positives = 36/72 (50%) Frame = +1 Query: 250 KRRGCGIVEFTNTEAMKKALFVMHRYELNGRKLVLKEETGNERRMHTSRPQHREGRNNRD 429 +R G G+VEFT E MK+A+ + + E G+++ L++E SR + GR +R Sbjct: 136 RRPGEGVVEFTTEEDMKRAIASLDKCEFYGKRIRLRQELPRS-GTSKSRSRSPSGRKSRS 194 Query: 430 DKDNWGINKPRE 465 PR+ Sbjct: 195 RSPRKRSRSPRK 206 >SB_1040| Best HMM Match : RRM_1 (HMM E-Value=1e-05) Length = 282 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/77 (25%), Positives = 40/77 (51%) Frame = +1 Query: 250 KRRGCGIVEFTNTEAMKKALFVMHRYELNGRKLVLKEETGNERRMHTSRPQHREGRNNRD 429 +++G G++EF + +KKAL + EL G+++ L + R SR + + ++ Sbjct: 201 QKQGEGVIEFATKKDLKKALRKLDGKELKGKRIRLIDSRSRSPRRSKSRSRSPSPKRDKV 260 Query: 430 DKDNWGINKPREPENLN 480 D + G + P + N+N Sbjct: 261 DDEARGGSPPPKEGNVN 277 >SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 593 Score = 35.9 bits (79), Expect = 0.036 Identities = 17/54 (31%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = +3 Query: 531 LVKKVFVANLDYKADQAKIKEVFKMAGKVRNIDLAVDK-DGNSRGFAVIEYDHP 689 L+ +V+V +++++ + I+ F G + IDL+ D + +GFA +EYD P Sbjct: 100 LMCRVYVGSINFELREEHIRTAFHPFGPINKIDLSWDPLNMKHKGFAFVEYDLP 153 >SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38) Length = 496 Score = 35.1 bits (77), Expect = 0.062 Identities = 17/64 (26%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = +3 Query: 495 FTIFGSINVQPPLVKKVFVANLDYKADQAKIKEVFKMAGKVRNIDLAVDK-DGNSRGFAV 671 F + S + ++K+F+ L++ + +K+ F G + +D + K DG SRGF Sbjct: 36 FALLPSKMSESEKLRKIFIGGLNWNTTEEGLKDYFSQWGTI--VDCVIMKRDGRSRGFGF 93 Query: 672 IEYD 683 + Y+ Sbjct: 94 VTYE 97 >SB_35697| Best HMM Match : RRM_1 (HMM E-Value=1.3e-19) Length = 168 Score = 34.7 bits (76), Expect = 0.082 Identities = 16/52 (30%), Positives = 29/52 (55%) Frame = +3 Query: 525 PPLVKKVFVANLDYKADQAKIKEVFKMAGKVRNIDLAVDKDGNSRGFAVIEY 680 PP +VFV + + ++ VF+ AG + + L +D +G +RG+A + Y Sbjct: 70 PPRGCEVFVGKIPRDLYEDELVPVFETAGPIYEVRLMMDFNGQNRGYAFVVY 121 >SB_30745| Best HMM Match : UIM (HMM E-Value=1.9) Length = 116 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +2 Query: 101 DRSSDXHRTESRRLFVSNIPYEFRWTELKD 190 +R S +++FVSNIP+E RW LKD Sbjct: 82 NRRSRSSGAPEKKVFVSNIPFESRWQNLKD 111 >SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) Length = 407 Score = 33.5 bits (73), Expect = 0.19 Identities = 14/50 (28%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = +3 Query: 537 KKVFVANLDYKADQAKIKEVFKMAGKVRNIDLAVD-KDGNSRGFAVIEYD 683 + VF+ NL + ++ ++E+F G V ++ L D K G +GF + ++ Sbjct: 56 RSVFIGNLPFDIEEEPLRELFTTCGNVESVRLIRDRKTGIGKGFGYVLFE 105 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +2 Query: 107 SSDXHRTESRRLFVSNIPYEFRWTELKDLFKEKVGDVAYVELLTD 241 S+D R +F+ N+P++ L++LF G+V V L+ D Sbjct: 47 SNDKAHDHQRSVFIGNLPFDIEEEPLRELF-TTCGNVESVRLIRD 90 >SB_28139| Best HMM Match : RRM_1 (HMM E-Value=3.7e-28) Length = 419 Score = 33.5 bits (73), Expect = 0.19 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = +3 Query: 543 VFVANLDYKADQAKIKEVFKMAGKVRNIDLAVDKDGNSRG 662 +++ NL D+A ++ +F GKV + + DKD NS+G Sbjct: 181 LYIQNLPQNCDEAMLENMFSKYGKVISTRILRDKDTNSKG 220 >SB_28089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 33.1 bits (72), Expect = 0.25 Identities = 18/72 (25%), Positives = 35/72 (48%) Frame = +1 Query: 250 KRRGCGIVEFTNTEAMKKALFVMHRYELNGRKLVLKEETGNERRMHTSRPQHREGRNNRD 429 +R+G G+VEF + MK AL + E G+++ LK + G + R ++ ++ Sbjct: 146 RRQGEGVVEFATKDDMKTALKKLDDTEFFGKRIRLKIKDGEGDALMEDREDDQKDAEEKE 205 Query: 430 DKDNWGINKPRE 465 + G + +E Sbjct: 206 EVAEAGAEEQQE 217 >SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18) Length = 268 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/49 (26%), Positives = 29/49 (59%) Frame = +3 Query: 537 KKVFVANLDYKADQAKIKEVFKMAGKVRNIDLAVDKDGNSRGFAVIEYD 683 K++FV + + +++++ F+ G V+ + DK G S+G+A I ++ Sbjct: 8 KRIFVKGFNRETTESELRAFFEEYGVVKESKIVRDKHGVSKGYAFITFE 56 >SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1291 Score = 32.7 bits (71), Expect = 0.33 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +3 Query: 519 VQPPLVKKVFVANLDYKADQAKIKEVFKMAGKVRNIDLAVDK-DGNSRGFAVIEY 680 V P K+F+ L ++ ++KE+ G++R +L D G S+G+A EY Sbjct: 667 VVPDSPHKIFIGGLPNYLNEDQVKELLSSFGELRAFNLVKDSATGLSKGYAFCEY 721 >SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 1026 Score = 32.3 bits (70), Expect = 0.44 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 4/55 (7%) Frame = +3 Query: 528 PLVKK--VFVANLDYKADQAKIKEVFKMAGKVRNIDLAVDKDGNS--RGFAVIEY 680 P++ K +FV NL Y A+ K F+ G ++ + DKD + RGF + + Sbjct: 15 PVISKTTIFVRNLPYNITDAEFKSAFEEIGPLKRGFIVKDKDNQNRCRGFGYVTF 69 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +3 Query: 543 VFVANLDYKADQAKIKEVFKMAGKVRNIDLAVDK-DGNSRGFAVIEY 680 VF+ NL + + Q I +FK G + + VD +S+G A ++Y Sbjct: 418 VFIRNLSFDSTQKNITNLFKQFGDIAYCKVVVDHLTQHSKGSAFVKY 464 >SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +3 Query: 528 PLVKKVFVANLDYKADQAKIKEVFKMAGKVRNIDLAVDKD-GNSRGFAVI 674 P V+V NL Y + + +VF+ GKV + + DK+ SRG A I Sbjct: 7 PSKSTVYVGNLPYSLTNSDLHKVFERYGKVVKVTILRDKETRESRGVAFI 56 >SB_47831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.9 bits (69), Expect = 0.58 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +2 Query: 137 RLFVSNIPYEFRWTELKDLFKEKVGDVAYVELLTD 241 ++FV NI ++ R ELKD F GDV Y +++ D Sbjct: 80 KVFVGNIGFKVRARELKDFF-GYFGDVVYAQIIMD 113 >SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 514 Score = 31.5 bits (68), Expect = 0.76 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +1 Query: 250 KRRGCGIVEFTNTEAMKKALFVMHRYELNGRKL 348 + +G G V+F EA K+A+ M+ +EL GR L Sbjct: 281 RSKGYGFVQFREAEAAKRAMEQMNGFELAGRPL 313 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 31.5 bits (68), Expect = 0.76 Identities = 18/56 (32%), Positives = 30/56 (53%) Frame = +2 Query: 92 ANRDRSSDXHRTESRRLFVSNIPYEFRWTELKDLFKEKVGDVAYVELLTDDSGKEE 259 ++R R R++ R + VS +P W +LKD +E GDV + ++ D +G E Sbjct: 367 SSRGRGPPPRRSDFR-VQVSGLPPTGSWQDLKDHMRE-AGDVLFTDVFKDGTGVVE 420 Score = 29.9 bits (64), Expect = 2.3 Identities = 17/44 (38%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = +2 Query: 107 SSDXHRTESR--RLFVSNIPYEFRWTELKDLFKEKVGDVAYVEL 232 SS+ +R+ S R++V N+P + R +L D+F K G +A V+L Sbjct: 250 SSNMNRSNSNDCRVYVGNLPQDVREKDLHDIF-YKYGHIADVDL 292 >SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 871 Score = 31.1 bits (67), Expect = 1.0 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 3/51 (5%) Frame = +3 Query: 537 KKVFVANL--DYKADQAKIKEVFKMAGKVRNIDLAVDK-DGNSRGFAVIEY 680 + +FV L D+K + IKE+F G V +A++ +G SRGFA ++Y Sbjct: 205 RTLFVDRLPRDFK-NGGLIKELFSQTGNVTFAQVAINPANGGSRGFAFVDY 254 >SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 31.1 bits (67), Expect = 1.0 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +3 Query: 576 QAKIKEVFKMAGKVRNIDLAVDK-DGNSRGFAVIEYDHP 689 Q IK++F G V + L D+ G S G+A + YD+P Sbjct: 40 QEDIKKIFGTVGNVTSCKLIRDRATGQSLGYAFVNYDNP 78 >SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35) Length = 1118 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/35 (37%), Positives = 24/35 (68%) Frame = +1 Query: 250 KRRGCGIVEFTNTEAMKKALFVMHRYELNGRKLVL 354 +R+G G++EF+ +K+AL + ELNG+++ L Sbjct: 131 QRQGEGVIEFSCKRDLKRALKKLDGEELNGKRIRL 165 >SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 420 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/53 (30%), Positives = 29/53 (54%) Frame = +3 Query: 537 KKVFVANLDYKADQAKIKEVFKMAGKVRNIDLAVDKDGNSRGFAVIEYDHPLK 695 KK+ V +LD+ +++E F+ G++ IDL ++ + R A I + LK Sbjct: 236 KKLMVQDLDFDTTVDELREYFEKCGELTGIDLLINSE--KRTCAAIVFFRNLK 286 >SB_11300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1148 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/53 (24%), Positives = 28/53 (52%) Frame = +3 Query: 522 QPPLVKKVFVANLDYKADQAKIKEVFKMAGKVRNIDLAVDKDGNSRGFAVIEY 680 +P + VF+ L ++ I E+F + G++ +I ++ K N+R F + + Sbjct: 346 KPEGCRTVFIGGLPESINEHIINEIFYVCGEITSIRISKGKGENARKFCHLRF 398 >SB_41149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 29.1 bits (62), Expect = 4.1 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 5/73 (6%) Frame = +3 Query: 537 KKVFVANLDYKADQAKIKEVFKMAGK--VRN---IDLAVDKDGNSRGFAVIEYDHPLKPY 701 K+ +V NL KA + + F + +R+ ++LAV+K G S GF + L + Sbjct: 5 KRFYVGNLSVKATREDLSHHFGLDATPYLRSSCWVELAVEKSGKSLGFGFVNVPKHLADH 64 Query: 702 RLFHV**PMLYDR 740 L H+ L+D+ Sbjct: 65 -LMHLNQTKLFDK 76 >SB_44114| Best HMM Match : RRM_1 (HMM E-Value=9.9e-35) Length = 929 Score = 28.7 bits (61), Expect = 5.4 Identities = 22/79 (27%), Positives = 36/79 (45%) Frame = +1 Query: 253 RRGCGIVEFTNTEAMKKALFVMHRYELNGRKLVLKEETGNERRMHTSRPQHREGRNNRDD 432 +RG G VEF + + A+ ++ +L G ++V++ G R GR+ RD Sbjct: 721 KRGYGFVEFDDHRDAEDAVHDLNGRDLIGERVVVEFSKG--------RRSEGGGRDRRDF 772 Query: 433 KDNWGINKPREPENLNTYG 489 G + R P L+ YG Sbjct: 773 SGRGGRDGGRRPMWLDKYG 791 >SB_37378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 781 Score = 28.7 bits (61), Expect = 5.4 Identities = 17/51 (33%), Positives = 27/51 (52%) Frame = +2 Query: 104 RSSDXHRTESRRLFVSNIPYEFRWTELKDLFKEKVGDVAYVELLTDDSGKE 256 +S +T RLFV P +F +L+ F E GD+ YV+++ D +E Sbjct: 44 KSDFQDQTTMTRLFVI-CPKDFNDEDLRSKF-ESFGDIEYVQIVRDHKTRE 92 >SB_56343| Best HMM Match : RRM_1 (HMM E-Value=3.2e-14) Length = 273 Score = 28.3 bits (60), Expect = 7.1 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +1 Query: 256 RGCGIVEFTNTEAMKKALFVMHRYELNGRKLVLKEETG 369 +GCG +E ++ KAL + H Y L GRK+ ++ G Sbjct: 114 KGCGFLEIDDSIGYTKALNLHHSY-LGGRKINVEVTCG 150 >SB_37749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1103 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +1 Query: 265 GIVEFTNTEAMKKALFVMHRYELNGRKLVLKEETGN 372 G+V T +E K + +HR EL+GR + + G+ Sbjct: 393 GLVTMTTSEEAAKCIQHLHRTELHGRAITVDRAKGD 428 >SB_56337| Best HMM Match : RVT_1 (HMM E-Value=1.7e-23) Length = 846 Score = 28.3 bits (60), Expect = 7.1 Identities = 16/64 (25%), Positives = 28/64 (43%) Frame = +1 Query: 328 ELNGRKLVLKEETGNERRMHTSRPQHREGRNNRDDKDNWGINKPREPENLNTYGLSLQFL 507 EL+ + E+ + ++ RP HR+GRN + ++ PEN + G Sbjct: 162 ELSRSQAASIEKQESVNKIEKDRPNHRQGRNKDGRRRQESRDRKPMPENRKSSGKCRNCE 221 Query: 508 DLSM 519 D+ M Sbjct: 222 DIPM 225 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 27.9 bits (59), Expect = 9.4 Identities = 20/84 (23%), Positives = 38/84 (45%) Frame = +1 Query: 223 CRIVDR*QWKRRGCGIVEFTNTEAMKKALFVMHRYELNGRKLVLKEETGNERRMHTSRPQ 402 CR++ + + + RG G +FT+ E KAL ++ + GR++ + R + P Sbjct: 209 CRVITQ-EGRSRGFGYADFTSKEDYNKAL-ELNGEDCCGREIRINPANSKPSRGGGNTP- 265 Query: 403 HREGRNNRDDKDNWGINKPREPEN 474 R G R + + + + P N Sbjct: 266 -RGGGRGRGGRGGFSGGRDQNPPN 288 >SB_28695| Best HMM Match : Ras (HMM E-Value=0) Length = 1058 Score = 27.9 bits (59), Expect = 9.4 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +1 Query: 361 ETGNERRMHTSRPQHREGRNNRDDKDNWGINKPRE 465 ETG E +H SRP + N+ DD DN + R+ Sbjct: 784 ETGEEFNLHRSRPLIHD-ENDDDDDDNGDADNGRD 817 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,764,134 Number of Sequences: 59808 Number of extensions: 429024 Number of successful extensions: 1345 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 1205 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1343 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2058295707 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -