BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0606 (756 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 26 0.33 X72577-1|CAA51169.1| 283|Apis mellifera Apidaecin precursor pro... 24 1.3 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 23 4.1 X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor pro... 22 5.4 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 26.2 bits (55), Expect = 0.33 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = +1 Query: 562 ITKLTKPKLRRYLKWLVKYVTLIWLLIKTVIVEDLLSLSMTTH*SRTGYS 711 ITK K ++R + ++ YV+L+WL + + LL + S TG S Sbjct: 143 ITKPLKYGVKRTPRRMIVYVSLVWLGAACISLPPLLIMGNEHTYSETGPS 192 >X72577-1|CAA51169.1| 283|Apis mellifera Apidaecin precursor protein. Length = 283 Score = 24.2 bits (50), Expect = 1.3 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +1 Query: 340 RKLVLKEETGNERRMHTS--RPQHREGRNNRDDKDNWGINKP 459 R+ L+ E GN R ++ S RP H R + + G N+P Sbjct: 89 REAELEAEPGNNRPVYISQPRPPHPRLRREAEPEAEPGNNRP 130 Score = 24.2 bits (50), Expect = 1.3 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +1 Query: 340 RKLVLKEETGNERRMHTS--RPQHREGRNNRDDKDNWGINKP 459 R+ L+ E GN R ++ S RP H R + + G N+P Sbjct: 145 REAELEAEPGNNRPVYISQPRPPHPRLRREAEPEAEPGNNRP 186 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 22.6 bits (46), Expect = 4.1 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +1 Query: 565 TKLTKPKLRRYLKWLVKYVTLIWLLIKTVIVEDLLSLSMTTH 690 T LT P L +YL + + VTL ++ T+ V ++ S TH Sbjct: 292 TSLTVPLLGKYLLFTMVLVTL--SVVVTIAVLNVNFRSPVTH 331 >X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor protein. Length = 168 Score = 22.2 bits (45), Expect = 5.4 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = +1 Query: 340 RKLVLKEETGNERRMHTSRPQHREGRNNRDDKDNWGINKP 459 R+ + E GN R ++ +P+ R R+ + G N+P Sbjct: 90 REAESEAEPGNNRPVYIPQPRPPHPRLRREPEAEPGNNRP 129 Score = 21.8 bits (44), Expect = 7.1 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +1 Query: 361 ETGNERRMHTSRPQHREGRNNRDDKDNWGINKP 459 E GN R ++ +P+ R R+ + G N+P Sbjct: 123 EPGNNRPVYIPQPRPPHPRLRREPEAEPGNNRP 155 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,410 Number of Sequences: 438 Number of extensions: 4128 Number of successful extensions: 14 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23753925 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -