BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0605 (774 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U46669-3|AAA85744.2| 737|Caenorhabditis elegans Regulator of g ... 29 3.7 AL034393-22|CAD36499.1| 655|Caenorhabditis elegans Hypothetical... 29 4.9 AL034393-21|CAA22320.2| 681|Caenorhabditis elegans Hypothetical... 29 4.9 AF497833-1|AAM18111.1| 655|Caenorhabditis elegans putative Na-H... 29 4.9 AF497832-1|AAM18110.1| 681|Caenorhabditis elegans putative Na-H... 29 4.9 Z92813-7|CAB07283.2| 758|Caenorhabditis elegans Hypothetical pr... 28 8.5 Z81055-9|CAB02898.3| 562|Caenorhabditis elegans Hypothetical pr... 28 8.5 >U46669-3|AAA85744.2| 737|Caenorhabditis elegans Regulator of g protein signalingprotein 6 protein. Length = 737 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +2 Query: 11 SVASASDSFGTPGNSISRKTRSTIDPTLLGTSTPYVAKSTRSGCS 145 + A AS S P S S +T++T PT TST T + + Sbjct: 648 AAAGASPSTSAPSTSTSVQTKTTTSPTKSPTSTTITTSGTTTSAT 692 >AL034393-22|CAD36499.1| 655|Caenorhabditis elegans Hypothetical protein Y18D10A.6b protein. Length = 655 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -2 Query: 74 ISFS*RCYYREYQTSRSRTPQN 9 ISF RCY E Q R RTP+N Sbjct: 491 ISFINRCYPNERQRKRRRTPRN 512 >AL034393-21|CAA22320.2| 681|Caenorhabditis elegans Hypothetical protein Y18D10A.6a protein. Length = 681 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -2 Query: 74 ISFS*RCYYREYQTSRSRTPQN 9 ISF RCY E Q R RTP+N Sbjct: 517 ISFINRCYPNERQRKRRRTPRN 538 >AF497833-1|AAM18111.1| 655|Caenorhabditis elegans putative Na-H exchanger isoform 8b protein. Length = 655 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -2 Query: 74 ISFS*RCYYREYQTSRSRTPQN 9 ISF RCY E Q R RTP+N Sbjct: 491 ISFINRCYPNERQRKRRRTPRN 512 >AF497832-1|AAM18110.1| 681|Caenorhabditis elegans putative Na-H exchanger isoform 8a protein. Length = 681 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -2 Query: 74 ISFS*RCYYREYQTSRSRTPQN 9 ISF RCY E Q R RTP+N Sbjct: 517 ISFINRCYPNERQRKRRRTPRN 538 >Z92813-7|CAB07283.2| 758|Caenorhabditis elegans Hypothetical protein T28A8.7 protein. Length = 758 Score = 27.9 bits (59), Expect = 8.5 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -2 Query: 464 ELITLPFVISFLLLNVAFDNKDLVLRLTLFEVFGD 360 +L LPF+I+ L+LNV +D++ R T+ GD Sbjct: 656 QLEKLPFLIATLVLNVDYDDEQNTFR-TICRAIGD 689 >Z81055-9|CAB02898.3| 562|Caenorhabditis elegans Hypothetical protein F01G10.10 protein. Length = 562 Score = 27.9 bits (59), Expect = 8.5 Identities = 18/68 (26%), Positives = 32/68 (47%) Frame = -1 Query: 279 VDRDMFSGVSGVVNDFDRLVDIELLEWSVSLPDTPGLDRDRFDINEHPDLVDLATYGVLV 100 VD+D FS + +F + E+L+ ++LP G+ + H + ++TY L Sbjct: 483 VDQDSFSDLGLFGAEFLEKLLTEILQMGIALPTMQGVILKSPKLTFHDRYLKVSTYFKLD 542 Query: 99 PSNVGSIV 76 GS+V Sbjct: 543 EEYAGSLV 550 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,072,363 Number of Sequences: 27780 Number of extensions: 310576 Number of successful extensions: 899 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 880 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 899 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1861650246 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -