BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0605 (774 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 23 4.2 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 23 4.2 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 5.5 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 5.5 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 22 5.5 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 22 5.5 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 22 5.5 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 22 7.3 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 21 9.6 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 21 9.6 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 21 9.6 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 22.6 bits (46), Expect = 4.2 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -2 Query: 521 SAYISGLCLSSGVVFPSLVELITLPFVISFLLLNV 417 S + S + S+GV FP +LP+ + LNV Sbjct: 295 SGFYSTIMYSNGVTFPQRNRFSSLPY-YKYKYLNV 328 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 22.6 bits (46), Expect = 4.2 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -2 Query: 521 SAYISGLCLSSGVVFPSLVELITLPFVISFLLLNV 417 S + S + S+GV FP +LP+ + LNV Sbjct: 295 SGFYSTIMYSNGVTFPQRNRFSSLPY-YKYKYLNV 328 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.2 bits (45), Expect = 5.5 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +1 Query: 199 PLKEFYVHKTIEVIDHTRN 255 P+KEF+ +T+++ D N Sbjct: 183 PVKEFWERRTLQISDGIEN 201 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.2 bits (45), Expect = 5.5 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +1 Query: 199 PLKEFYVHKTIEVIDHTRN 255 P+KEF+ +T+++ D N Sbjct: 236 PVKEFWERRTLQISDGIEN 254 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.2 bits (45), Expect = 5.5 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +1 Query: 439 ITNGSVISSTNEGNTTP 489 ++ GSV+ +T E NT P Sbjct: 440 VSGGSVLRATKEYNTVP 456 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.2 bits (45), Expect = 5.5 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +1 Query: 439 ITNGSVISSTNEGNTTP 489 ++ GSV+ +T E NT P Sbjct: 440 VSGGSVLRATKEYNTVP 456 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.2 bits (45), Expect = 5.5 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +1 Query: 439 ITNGSVISSTNEGNTTP 489 ++ GSV+ +T E NT P Sbjct: 440 VSGGSVLRATKEYNTVP 456 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.8 bits (44), Expect = 7.3 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -2 Query: 674 LTFNDFDFKPARLFLTVPNISYSL 603 LT N FD+ P LTV S+++ Sbjct: 229 LTSNTFDYDPRYTKLTVAGESFTV 252 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 21.4 bits (43), Expect = 9.6 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -2 Query: 674 LTFNDFDFKPARLFLTVPNISYS 606 LT N FD+ P +T+ SY+ Sbjct: 226 LTSNTFDYDPKFTKMTIDGESYT 248 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.4 bits (43), Expect = 9.6 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -2 Query: 674 LTFNDFDFKPARLFLTVPNISYS 606 LT N FD+ P +T+ SY+ Sbjct: 226 LTSNTFDYDPKFTKMTIDGESYT 248 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.4 bits (43), Expect = 9.6 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -2 Query: 674 LTFNDFDFKPARLFLTVPNISYS 606 LT N FD+ P +T+ SY+ Sbjct: 226 LTSNTFDYDPKFTKMTIDGESYT 248 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,020 Number of Sequences: 438 Number of extensions: 3961 Number of successful extensions: 13 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24275400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -